PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00042231-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family VOZ
Protein Properties Length: 305aa    MW: 34097.4 Da    PI: 4.8379
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00042231-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ1302e-40217305189
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaataksp 89 
                       ppp +flgpkc+lwdc+r aqgs+w+qdycs+fh ++alneg+p + p+lrp+gidlkdgllfaal ak+  k  gipe egaat+ksp
  PSME_00042231-RA 217 PPPKSFLGPKCSLWDCPRLAQGSDWCQDYCSNFHGMVALNEGPPCMGPILRPGGIDLKDGLLFAALGAKTMVKYFGIPEYEGAATKKSP 305
                       89**************************************************************************************9 PP

Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
ECALKTDQDQ ASNRQIMEKR SKSMPKSTNH QLFKTKAKNK VRKESRVNDA LVLEEQVHQL  60
PWECKAELHE ESLTTSMLEE ILCSSYLSCD MWHLLQLHEE EDDATSILAA PYSSKLQLNE  120
NNLEAANPSS FQEAIPPNEM RKDFYVDHAN AKAQNIDRTS RSENIHTESL LQTTDKGLEA  180
AAQMNQDFDH NLCLSLDPDV EEENIPKFQG PCPGISPPPK SFLGPKCSLW DCPRLAQGSD  240
WCQDYCSNFH GMVALNEGPP CMGPILRPGG IDLKDGLLFA ALGAKTMVKY FGIPEYEGAA  300
TKKSP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010657013.13e-74PREDICTED: transcription factor VOZ1
RefseqXP_019079230.13e-74PREDICTED: transcription factor VOZ1
RefseqXP_021907726.18e-75transcription factor VOZ1
TrEMBLA0A438EGC15e-75A0A438EGC1_VITVI; Transcription factor VOZ1
TrEMBLA5CA229e-75A5CA22_VITVI; Uncharacterized protein
TrEMBLF6H4X22e-74F6H4X2_VITVI; Uncharacterized protein
STRINGVIT_12s0028g02670.t013e-75(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.25e-63vascular plant one zinc finger protein