PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00040474-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family M-type_MADS
Protein Properties Length: 538aa    MW: 60523.1 Da    PI: 6.9085
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00040474-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF702.2e-22751141150
                       HHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF  11 vtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 
                       vtfskR ng+lKKA+ELSvLCdaev ++ifs++gklye++
  PSME_00040474-RA  75 VTFSKRGNGLLKKAYELSVLCDAEVGLMIFSPRGKLYEFA 114
                       9**************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006621.78257117IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-175979IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-1962116IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.1E-1967120IPR002100Transcription factor, MADS-box
PfamPF003193.2E-1975113IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-177994IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-1794115IPR002100Transcription factor, MADS-box
SuperFamilySSF819011.19E-11192263No hitNo description
Gene3DG3DSA:1.25.40.102.9E-13207264IPR011990Tetratricopeptide-like helical domain
SMARTSM006716.4E-7229264IPR006597Sel1-like repeat
PfamPF077144.5E-6368484IPR001245Serine-threonine/tyrosine-protein kinase catalytic domain
Gene3DG3DSA:1.10.510.101.9E-12383492No hitNo description
SuperFamilySSF561121.66E-15385491IPR011009Protein kinase-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006468Biological Processprotein phosphorylation
GO:0003677Molecular FunctionDNA binding
GO:0004672Molecular Functionprotein kinase activity
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MGTEDEHRAI PIENRKVLQD PGEGTHPRGI LPTACKNHLM SLVGDVEVLI FSGIVLRGKP  60
TAGRKKENNP WEILVTFSKR GNGLLKKAYE LSVLCDAEVG LMIFSPRGKL YEFANTRRQM  120
ILLLEEEEVK EVAQGESGEE DENSLESGVI NKDSDEWDKF RHMEDSSMDE LDPGSWRKIL  180
DETLSRENIS SNEEGLYVFG VNKMMFAGTD RDFEHAAEAY MHAHSQSNAQ AMFNLGYMHE  240
HGEGLPFDFH LAKRYYDQAL ETDRAAKLPV MLALMSVWIR KNYGGSCLVT LIDSLPNMLP  300
KLGKWLKKTL IDDGNVTLVT LFACLLTVLY LCDRQRVLKA VKCGKYDCAE TKASSWGSLG  360
CSSSTDTHIQ ETEKNPKIYQ TIEVSLVSGH LTSRSDVYSF GVVLLEMLTG RRSMDKNRPS  420
GEHNLVEWAR PCLGEKRRLY RLIDPRLEGK FSIKGAQKSA QLACHCLSRD PKVRPLMSEV  480
VEALKPLMNL KDMASSSFHY QALQAERANR QQQLENGNGQ LKNVAYLNGQ LSSKNGRP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j5t_A4e-28366510249399Probable serine/threonine-protein kinase PBL2
6j5t_D4e-28366510249399Probable serine/threonine-protein kinase PBL2
6j5t_I4e-28366510249399Probable serine/threonine-protein kinase PBL2
6j5t_J4e-28366510249399Probable serine/threonine-protein kinase PBL2
6j5t_M4e-28366510249399Probable serine/threonine-protein kinase PBL2
6j5u_C4e-28366510249399Probable serine/threonine-protein kinase PBL2
6j5v_C4e-28366510249399Probable serine/threonine-protein kinase PBL2
6j6i_A4e-28366510249399Probable serine/threonine-protein kinase PBL2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6786320.0EF678632.1 Picea sitchensis clone WS0292_F16 unknown mRNA.
GenBankEF6787380.0EF678738.1 Picea sitchensis clone WS0298_G02 unknown mRNA.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.13e-18AGAMOUS-like 20