PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00037370-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family VOZ
Protein Properties Length: 276aa    MW: 30413.1 Da    PI: 4.3296
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00037370-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ137.51e-42185271288
               VOZ   2 ppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaataks 88 
                       pp aflgpkcalwdc+rp+qgs+w+qdycs+fh ++alneg+pg++pvlrp+gi lkdgllfaal ak+  k+ gipecega+t+k 
  PSME_00037370-RA 185 PPEAFLGPKCALWDCPRPTQGSNWCQDYCSNFHGMVALNEGPPGMRPVLRPGGIYLKDGLLFAALGAKTVVKSFGIPECEGATTTKI 271
                       799*********************************************************************************996 PP

Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MFTDLQQVRK ESRVNGALVL EERVHQLPHE CKAKLHEESP TTSMLEASLC SSNLSCDMWH  60
LLQLHEEEDD ATSILAAPYS SKIQLNENTL EAANPSSFQE AIPPNEMRND FYVDHANAEA  120
QNIDGTSRSE NIHTESLLQT TNEGLEAVAQ MNQDFDNNLC LSLDPEVEEE HIPKFQGPCP  180
GISLPPEAFL GPKCALWDCP RPTQGSNWCQ DYCSNFHGMV ALNEGPPGMR PVLRPGGIYL  240
KDGLLFAALG AKTVVKSFGI PECEGATTTK ITLECT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011626288.11e-74transcription factor VOZ1
RefseqXP_011626289.11e-74transcription factor VOZ1
TrEMBLW1Q0P13e-73W1Q0P1_AMBTC; Uncharacterized protein
STRINGERN140214e-74(Amborella trichopoda)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.22e-65vascular plant one zinc finger protein