PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00035379-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family TALE
Protein Properties Length: 157aa    MW: 18324.4 Da    PI: 5.7138
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00035379-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.65.7e-10931272155
                       HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
          Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                       k +yps++++  LA+++gL+++q+ +WF N+R ++
  PSME_00035379-RA  93 KWPYPSETDKVTLAESTGLDQKQINNWFINQRKRH 127
                       679*****************************985 PP

2ELK30.11.1e-105068422
               ELK  4 hqLlrKYsgyLgsLkqEFs 22
                      +qLlrKYsg+ +sLkqEF+
  PSME_00035379-RA 50 NQLLRKYSGCFSSLKQEFL 68
                      8*****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011887.0E-54768IPR005539ELK domain
PROSITE profilePS512139.2024767IPR005539ELK domain
PfamPF037891.3E-85068IPR005539ELK domain
PROSITE profilePS5007112.35767130IPR001356Homeobox domain
SuperFamilySSF466892.05E-1969142IPR009057Homeodomain-like
SMARTSM003891.8E-1269134IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-2772132IPR009057Homeodomain-like
CDDcd000864.67E-1279131No hitNo description
PfamPF059206.4E-1887126IPR008422Homeobox KN domain
PROSITE patternPS000270105128IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MQANVASQDK GYCDERERED GGGSSDEEFS FGEIEVHEVD PRAEDRELIN QLLRKYSGCF  60
SSLKQEFLKK KKKGKLPKDA RQKLLEWWNV HYKWPYPSET DKVTLAESTG LDQKQINNWF  120
INQRKRHWKP SEDMQFVVMD SLNPHGASFY MDGGAEC
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1125861e-176BT112586.1 Picea glauca clone GQ03317_P14 mRNA sequence.
GenBankAY6804051e-176AY680405.1 Picea mariana homeobox transcription factor KN4 (Kn4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010059832.15e-62PREDICTED: homeobox protein knotted-1-like 2
RefseqXP_010059833.15e-62PREDICTED: homeobox protein knotted-1-like 2
RefseqXP_015572849.13e-62PREDICTED: homeotic protein knotted-1
SwissprotO041353e-63KNAP2_MALDO; Homeobox protein knotted-1-like 2
TrEMBLA0A0S2CBH71e-84A0A0S2CBH7_PINPS; Homeobox transcription factor KN4
STRINGPOPTR_0002s11400.12e-62(Populus trichocarpa)
STRINGGLYMA0041S00360.27e-61(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-54KNOTTED-like from Arabidopsis thaliana