PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00033701-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family VOZ
Protein Properties Length: 890aa    MW: 99736.2 Da    PI: 6.5869
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00033701-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ343.59.8e-1062404441217
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                       ppp+aflgpkcalwdc+rpaqg++w+q+ycs fh  la neg+p ++pvlrp+gidlkdg+lf alsak+q k vgipece            
  PSME_00033701-RA 240 PPPAAFLGPKCALWDCSRPAQGTKWCQEYCSDFHMILASNEGAPRMRPVLRPGGIDLKDGPLFTALSAKTQEKVVGIPECE------------ 320
                       89******************************************************************************8............ PP

               VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrle 186
                       elfd+ ++ege++rewlffdkpr  fesgnrkq sl dysgrgwhesrkqv+k+fgglkrsyymd qps++fewhlyeyein++da+alyrle
  PSME_00033701-RA 321 ELFDMYVIEGESMREWLFFDKPRWDFESGNRKQCSLLDYSGRGWHESRKQVIKDFGGLKRSYYMDAQPSTQFEWHLYEYEINDCDACALYRLE 413
                       9******************************************************************************************** PP

               VOZ 187 lklvdekksakgkvskdsladlqkklgrlta 217
                       lk+v +kk++kgkv  d+l+dlq++lg+l+a
  PSME_00033701-RA 414 LKMVCSKKNTKGKVGGDPLVDLQHQLGKLSA 444
                       *****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.70.3301.6E-884143IPR012677Nucleotide-binding alpha-beta plait domain
SuperFamilySSF525405.75E-25436598IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM004875.7E-6448616IPR014001Helicase superfamily 1/2, ATP-binding domain
Gene3DG3DSA:3.40.50.3009.2E-15449525IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF002705.3E-10454531IPR011545DEAD/DEAH box helicase domain
PROSITE profilePS5119211.383461604IPR014001Helicase superfamily 1/2, ATP-binding domain
CDDcd000468.03E-8469583No hitNo description
Gene3DG3DSA:3.40.50.3001.1E-6537618IPR027417P-loop containing nucleoside triphosphate hydrolase
SuperFamilySSF525402.43E-12635711IPR027417P-loop containing nucleoside triphosphate hydrolase
Gene3DG3DSA:3.40.50.3002.2E-11654717IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF002701.3E-6661704IPR011545DEAD/DEAH box helicase domain
CDDcd000463.58E-5676716No hitNo description
SuperFamilySSF537951.62E-42727872No hitNo description
PfamPF012931.3E-40731837IPR001272Phosphoenolpyruvate carboxykinase, ATP-utilising
Gene3DG3DSA:3.90.228.203.1E-53731889IPR013035Phosphoenolpyruvate carboxykinase, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006094Biological Processgluconeogenesis
GO:0003676Molecular Functionnucleic acid binding
GO:0004612Molecular Functionphosphoenolpyruvate carboxykinase (ATP) activity
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 890 aa     Download sequence    Send to blast
MIHTAGQSSA YSSSFLLRRV QTDSSRGFFL TIRSQEEEGE QYQIGRVFKS FREMAWEKPK  60
IGNVWNTVKP FVNGGASGML ATCVIQPVDM IKYVDYHMGE ESGYVRFEQP EMVQKPRATV  120
VLAEEGGGLV VKNYIAVLEA VEGMCIFFCG CVVKLRRNTR LSSVKVKISV GNLQATDFLV  180
DDLHTPEKYF ERGLEVTSGL EGGQINFHQD YIPAAQPIFT LTGEEETSPV FNGPQPGLCP  240
PPAAFLGPKC ALWDCSRPAQ GTKWCQEYCS DFHMILASNE GAPRMRPVLR PGGIDLKDGP  300
LFTALSAKTQ EKVVGIPECE ELFDMYVIEG ESMREWLFFD KPRWDFESGN RKQCSLLDYS  360
GRGWHESRKQ VIKDFGGLKR SYYMDAQPST QFEWHLYEYE INDCDACALY RLELKMVCSK  420
KNTKGKVGGD PLVDLQHQLG KLSAEFSWFR HFNPIQTQVF TVLYNSDDNV LVATPTGSGK  480
TICAEFSLLR LHKKGTDSVF RCVYIAPIEA LSKERYRDWE QKFGKGLELR WKQCKLVQQV  540
SLFIVDELHL IGGEGGPILE VIVSRMRYIS SQIENRIRII ALSTSLANAK DLGEWIGATV  600
HGLFNFPPGV RPVPIEIHIQ FSTWCASCTN SELLELQPIP VSALRNPSYE ALYQQFRHFN  660
PIQTQVFTVL YNSDDNVLIA APTGSGKTIC AEFALLQLHQ KGKQRKLVEQ VILFIVDELH  720
LIGGEGGPIL EVAGTEDGIK EPRATFLACF GAAFIMLHPT KYASMLAEKM KQHGTTACLV  780
NTGWSGGSYG VGRRIKLAYT RSIIDAIHNG SLLHANYSQT SIFGLNVSDK VEGVPAEILR  840
PENMWANSLE YADTLQNLAR LFKNNFEKFV DYKIGDDSTL AQQILAASPQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jcr_C1e-5844969812991542hBrr2
5o9z_C1e-5844969812991542U5 small nuclear ribonucleoprotein 200 kDa helicase
5xjc_D1e-5844969812991542U5 small nuclear ribonucleoprotein 200 kDa helicase
5yzg_D1e-5844969812991542U5 small nuclear ribonucleoprotein 200 kDa helicase
5z56_D1e-5844969812991542U5 small nuclear ribonucleoprotein 200 kDa helicase
5z57_D1e-5844969812991542U5 small nuclear ribonucleoprotein 200 kDa helicase
5z58_D1e-5844969812991542U5 small nuclear ribonucleoprotein 200 kDa helicase
6ah0_D1e-5844969812991542U5 small nuclear ribonucleoprotein 200 kDa helicase
6ahd_D1e-5844969812991542Brr2, U5 small nuclear ribonucleoprotein 200 kDa helicase
6ff7_r1e-5844969812991542U5 small nuclear ribonucleoprotein 200 kDa helicase
6icz_D1e-5844969812991542U5 small nuclear ribonucleoprotein 200 kDa helicase
6qw6_5B1e-5844969812991542U5 small nuclear ribonucleoprotein 200 kDa helicase
6qx9_5B1e-5844969812991542U5 small nuclear ribonucleoprotein 200 kDa helicase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1185317e-71BT118531.1 Picea glauca clone GQ04007_G03 mRNA sequence.
GenBankEF6772867e-71EF677286.1 Picea sitchensis clone WS02764_M18 unknown mRNA.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-103vascular plant one zinc finger protein