PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00029903-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family VOZ
Protein Properties Length: 309aa    MW: 34717.8 Da    PI: 4.8029
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00029903-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ166.11.8e-51104202199
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                       ppp+aflgpkcalwd +rpaqg++w+qdycs fh tla neg+p ++pvlrp+gid+kdg+lfaalsak+q k vgipecegaatakspwna 
  PSME_00029903-RA 104 PPPAAFLGPKCALWDYSRPAQGTKWCQDYCSDFHMTLASNEGAPRMRPVLRPGGIDIKDGPLFAALSAKTQEKAVGIPECEGAATAKSPWNAY 196
                       89******************************************************************************************* PP

               VOZ  94 elfdls 99 
                       elfd+ 
  PSME_00029903-RA 197 ELFDMY 202
                       ****86 PP

2VOZ1722.9e-53204302119217
               VOZ 119 fesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakgkvskdsladlqkk 211
                       fesgnrkqrslpdysgrgwhesrkqv+k+fgglkrsyymdpqps++fewhl eye+n++da+alyrlelk+  +kk++kgkv  d+l+dlq++
  PSME_00029903-RA 204 FESGNRKQRSLPDYSGRGWHESRKQVIKDFGGLKRSYYMDPQPSTQFEWHLNEYEMNDCDACALYRLELKIFFSKKNTKGKVGGDPLVDLQHQ 296
                       9******************************************************************************************** PP

               VOZ 212 lgrlta 217
                       lg+l+a
  PSME_00029903-RA 297 LGKLSA 302
                       ****97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
DFIVDDLHTP EKYFERVSRC TNIGEGLHQN SYPQTSEQLP ANIEHQENNN YVQTSEQFPP  60
SLVEGLEVTS GLEDYIPAAQ PIFTLTGEEE TSPVFNGPQP GLCPPPAAFL GPKCALWDYS  120
RPAQGTKWCQ DYCSDFHMTL ASNEGAPRMR PVLRPGGIDI KDGPLFAALS AKTQEKAVGI  180
PECEGAATAK SPWNAYELFD MYDFESGNRK QRSLPDYSGR GWHESRKQVI KDFGGLKRSY  240
YMDPQPSTQF EWHLNEYEMN DCDACALYRL ELKIFFSKKN TKGKVGGDPL VDLQHQLGKL  300
SADFSWVAK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1153898e-50BT115389.1 Picea glauca clone GQ03615_G11 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010657013.11e-109PREDICTED: transcription factor VOZ1
RefseqXP_019079230.11e-109PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ01e-102VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA5CA221e-108A5CA22_VITVI; Uncharacterized protein
TrEMBLF6H4X21e-108F6H4X2_VITVI; Uncharacterized protein
STRINGVIT_12s0028g02670.t011e-108(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-105vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]