PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00029721-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family VOZ
Protein Properties Length: 627aa    MW: 70499.2 Da    PI: 8.6311
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00029721-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ2781.1e-8519837536198
               VOZ  36 tlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwna...............aelfdlsllegetirewlffd 113
                       + ++ eg+p ++pvlrp+gidlkdg+lfaalsak+q k vgipecega+takspwna                +lfd+ +le+e++rewlffd
  PSME_00029721-RA 198 QATVGEGAPRMRPVLRPGGIDLKDGPLFAALSAKTQEKAVGIPECEGATTAKSPWNAyarvyifavymmvplEQLFDMYVLESESMREWLFFD 290
                       556789**************************************************9555555444444433379****************** PP

               VOZ 114 kprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakg 198
                       kprrafesgn+kqrslpdysgrgwhesrkqv+k+fgglkrsyymdpqps++fewh yeyein++da+alyrlelk+v +kk++k 
  PSME_00029721-RA 291 KPRRAFESGNQKQRSLPDYSGRGWHESRKQVIKDFGGLKRSYYMDPQPSTQFEWHHYEYEINDCDACALYRLELKMVCSKKNTKD 375
                       *********************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5001110.0971143IPR000719Protein kinase domain
SuperFamilySSF561121.22E-201174IPR011009Protein kinase-like domain
PfamPF000696.8E-111574IPR000719Protein kinase domain
Gene3DG3DSA:1.10.510.108.5E-171587No hitNo description
Gene3DG3DSA:3.40.50.3004.3E-10371435IPR027417P-loop containing nucleoside triphosphate hydrolase
SuperFamilySSF525401.11E-12373468IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF002707.0E-8374439IPR011545DEAD/DEAH box helicase domain
CDDcd000462.01E-5377436No hitNo description
SuperFamilySSF537952.98E-44464607No hitNo description
PfamPF012931.6E-43467574IPR001272Phosphoenolpyruvate carboxykinase, ATP-utilising
Gene3DG3DSA:3.90.228.201.3E-55468627IPR013035Phosphoenolpyruvate carboxykinase, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006094Biological Processgluconeogenesis
GO:0006468Biological Processprotein phosphorylation
GO:0003676Molecular Functionnucleic acid binding
GO:0004612Molecular Functionphosphoenolpyruvate carboxykinase (ATP) activity
GO:0004672Molecular Functionprotein kinase activity
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 627 aa     Download sequence    Send to blast
MRDETRPLEV KGEPNISYIC SRYYRAPELK FGAIEYKTTI DMWSVGCVLA ELLLGQPLFP  60
GESVVDQLVE IIKHTAGQSS AYSSSFLLRR VQTDSSHGFF LTIRSQEEEG EQYQIGRVFK  120
SFREMAGENP KTGNVWNTVK PFVNGGASGM LMTCVIQPVD MIKVFALCLP VMLRFLVKLR  180
RNTGLSSVKV KISVGNLQAT VGEGAPRMRP VLRPGGIDLK DGPLFAALSA KTQEKAVGIP  240
ECEGATTAKS PWNAYARVYI FAVYMMVPLE QLFDMYVLES ESMREWLFFD KPRRAFESGN  300
QKQRSLPDYS GRGWHESRKQ VIKDFGGLKR SYYMDPQPST QFEWHHYEYE INDCDACALY  360
RLELKMVCSK KNTKDDNVLV ATPTGSGKTI RAEFSLLRLH QKGTDSVFRC VYIAPIEALA  420
KERYRDWEQK FGKGLELRWK QRKLVQQVSL FIVDELQLIG GECGPILEVA GTEDGIKEPR  480
ATFSACFGAA FIMLHPTKYA SMLAEKMKQH GTTACLVNTG WSGGSYGVGR RIKLAYTRSI  540
IDAIHNGSLL QANYSQTSIF GLNVPDKVEG VPAEILCPKN MWANSLEYVD TLQKLARLFK  600
NNFEKFVDYK IGDDSTLSQQ ILAAGPQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1j3b_A4e-40469627376527ATP-dependent phosphoenolpyruvate carboxykinase
1j3b_B4e-40469627376527ATP-dependent phosphoenolpyruvate carboxykinase
1xkv_A4e-40469627376527ATP-dependent phosphoenolpyruvate carboxykinase
1xkv_B4e-40469627376527ATP-dependent phosphoenolpyruvate carboxykinase
2pc9_A4e-40469627376527Phosphoenolpyruvate carboxykinase [ATP]
2pc9_B4e-40469627376527Phosphoenolpyruvate carboxykinase [ATP]
2pc9_C4e-40469627376527Phosphoenolpyruvate carboxykinase [ATP]
2pc9_D4e-40469627376527Phosphoenolpyruvate carboxykinase [ATP]
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1185311e-71BT118531.1 Picea glauca clone GQ04007_G03 mRNA sequence.
GenBankEF6772861e-71EF677286.1 Picea sitchensis clone WS02764_M18 unknown mRNA.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-79vascular plant one zinc finger protein