PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00028475-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family VOZ
Protein Properties Length: 191aa    MW: 21472.2 Da    PI: 4.2815
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00028475-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ107.81.2e-3310519141125
               VOZ  41 eglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa..elfdlsllegetirewlffdkprrafesgnrk 125
                         +pg+ p+lrp+gidlkdgllf al  k+  k+ gipecegaat+k   + +  elfdl +l ge irewlffdkp+r fesgnrk
  PSME_00028475-RA 105 TSTPGMGPILRPGGIDLKDGLLFVALGDKTVVKSFGIPECEGAATKKITLECTwyELFDLFVLLGEVIREWLFFDKPQRDFESGNRK 191
                       3689*******************************************98877555*******************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MVVHQLPREC KAELHEESPT TSMLEASLCS SDLSCDMWHL LQLHEEEDDA TSILAASYSS  60
KLQLNENTLE AANTSSFQEA IPPNEMRKEF YVDHANAEAQ NIDWTSTPGM GPILRPGGID  120
LKDGLLFVAL GDKTVVKSFG IPECEGAATK KITLECTWYE LFDLFVLLGE VIREWLFFDK  180
PQRDFESGNR K
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A426X3X92e-32A0A426X3X9_ENSVE; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.24e-30vascular plant one zinc finger protein