PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00027998-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family VOZ
Protein Properties Length: 164aa    MW: 17933.2 Da    PI: 6.252
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00027998-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ145.63.5e-455101197
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                       ppp  flgpkcalwd +rpaqgs+w+qdycs+fh t+ +neg+pg+ p+lrp+gidlkdgllf +l ak+  k+ gi ecegaat+kspwn +
  PSME_00027998-RA   5 PPPEDFLGPKCALWDFPRPAQGSDWCQDYCSNFHGTVDFNEGPPGMGPILRPGGIDLKDGLLFVSLGAKTMQKDFGIHECEGAATTKSPWNEP 97 
                       89*****************************************************************************************99 PP

               VOZ  94 elfd 97 
                        + d
  PSME_00027998-RA  98 SMVD 101
                       8875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MGISPPPEDF LGPKCALWDF PRPAQGSDWC QDYCSNFHGT VDFNEGPPGM GPILRPGGID  60
LKDGLLFVSL GAKTMQKDFG IHECEGAATT KSPWNEPSMV DSKKNTKAKV MGDYVSDFQH  120
KIGRLSAELA VDTKGSTKGR TKLTQKNVVQ YGYYVEEANG YYGT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018683795.15e-51PREDICTED: transcription factor VOZ1-like isoform X2
SwissprotQ9SGQ02e-45VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A061GG714e-46A0A061GG71_THECC; Vascular plant one zinc finger protein isoform 2 (Fragment)
STRINGEOY281331e-46(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.28e-48vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]