PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00026647-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family VOZ
Protein Properties Length: 309aa    MW: 34844.2 Da    PI: 4.472
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00026647-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ2152e-661843091126
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                       ppp aflgp+calwdc+r aqgs+w+qdycs+fh ++alneg+pg+ p+l p+gidlkdgllf al ak   k  gip+cegaat+kspwna+
  PSME_00026647-RA 184 PPPKAFLGPECALWDCPRLAQGSDWCQDYCSNFHGMVALNEGPPGMGPILLPGGIDLKDGLLFVALGAKNVVKYFGIPKCEGAATKKSPWNAP 276
                       89******************************************************************************************* PP

               VOZ  94 elfdlsllegetirewlffdkprrafesgnrkq 126
                       elfdl +l+ge irewlffdkprr fesgnrkq
  PSME_00026647-RA 277 ELFDLFFLQGEVIREWLFFDKPRRDFESGNRKQ 309
                       ********************************9 PP

Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MFTDLQQVRK ESRVNDALVL EEQVHLLLRE CKAELHEESP TTSMLEASLC SSDLSCDMWR  60
LLQLHEEEDD ATSILAAPYN SKLQLNENTL EAANPSSFQE AIQPNEMRKD FYVDHANAEA  120
QNINGTSRSK NIHTESLLQN TDESLEAATQ MNRYFDHNLC LSLDPEVEEE HIPKFQGPCP  180
RISPPPKAFL GPECALWDCP RLAQGSDWCQ DYCSNFHGMV ALNEGPPGMG PILLPGGIDL  240
KDGLLFVALG AKNVVKYFGI PKCEGAATKK SPWNAPELFD LFFLQGEVIR EWLFFDKPRR  300
DFESGNRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003529356.11e-102transcription factor VOZ1
RefseqXP_028241113.11e-102transcription factor VOZ1-like
SwissprotQ9SGQ09e-90VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A445JZB41e-101A0A445JZB4_GLYSO; Transcription factor VOZ1
TrEMBLI1KLR21e-101I1KLR2_SOYBN; Uncharacterized protein
STRINGGLYMA07G32374.21e-101(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.26e-81vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]