PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00023534-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family M-type_MADS
Protein Properties Length: 555aa    MW: 55351.5 Da    PI: 9.6857
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00023534-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF824e-26857150
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                      krien +nrqvtfskRrng+lKKA+EL vLCda v ++ifs++gkly+++
  PSME_00023534-RA  8 KRIENATNRQVTFSKRRNGLLKKAYELLVLCDAPVGLMIFSPRGKLYDFA 57
                      79***********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.422160IPR002100Transcription factor, MADS-box
SMARTSM004329.9E-34159IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.27E-25260IPR002100Transcription factor, MADS-box
CDDcd002651.05E-34262No hitNo description
PRINTSPR004047.1E-27222IPR002100Transcription factor, MADS-box
PfamPF003191.7E-23956IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-272237IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-273758IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MRGKTLMKRI ENATNRQVTF SKRRNGLLKK AYELLVLCDA PVGLMIFSPR GKLYDFANPS  60
NHLCMSAGSS PTFSSLGIMF STSTTAAATS VGFPLFGGSI SETNGMNLVP FLFFGKSSAA  120
SAIAKMDSKL RIPETIPQVE PSSVIGEDHS FKISTSGANF TVKFQNELKI SAVSPSPSLL  180
GVTDGTSSTL SSTAAISAST SSLFPNTQSA FAGSLFGQAS SSSTATTSAP FAFGSSANMP  240
FLSSSLPPAS LFSSSTLCGN TSPSLFGSTL SASASSASGS LFGLTAPSSS GSFSVPSFGL  300
SNSSTSQFSS IITPESGSGT TPTFGAASSP SVGSTGTSSF SSSSRYSFGL GSSSEFGSNT  360
SPSFGLSTTP QFGSSTSPSF GLSTTPQFGS STSPSFGLST TPQFNSSTSP SFGITNIPQS  420
SSSTAPSLGS GVTFGSNTTS SFATGSTPSF GSGSTPAFAS RSIFPFVSGS TPSFVSGSTF  480
GSSSSPSFGA SSSLFGSASA PSFGGSSVSF STTNNPAFGG SSASYGSAST SFYGSSNTPS  540
FGMGQSFGDS SATSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1113018e-45BT111301.1 Picea glauca clone GQ03235_L08 mRNA sequence.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.13e-27AGAMOUS-like 20