PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00020870-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family HB-other
Protein Properties Length: 556aa    MW: 62864.9 Da    PI: 7.9333
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00020870-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.27.6e-201368257
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                      +kR+  t++q+e Le+++++++yps++++ +L+++lgLte+qV+ WF+ rR k+k+
  PSME_00020870-RA 13 KKRRLKTPQQVEGLESFYAEHKYPSEAMKSQLSEELGLTEKQVQGWFCHRRLKDKR 68
                      89****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.811969IPR001356Homeobox domain
SMARTSM003893.1E-201173IPR001356Homeobox domain
SuperFamilySSF466894.19E-181177IPR009057Homeodomain-like
CDDcd000867.19E-171368No hitNo description
Gene3DG3DSA:1.10.10.601.0E-191368IPR009057Homeodomain-like
PfamPF000462.6E-171368IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MDSEEDKISP ENKKRRLKTP QQVEGLESFY AEHKYPSEAM KSQLSEELGL TEKQVQGWFC  60
HRRLKDKRLM KEEACNNGKQ DPQNGIMQDS VNGVKQDSSG SGKKTDNQRH LKCKEVENQR  120
FVNAIDYPAA VLASELRDHD LFKVNHENME DTFAGSSSAS QERSSLQSGN PYETEARRRP  180
FQNGKHYDFE GKRKNRSSYM NPYSEENDEH EAIAAVREQL GDEYREDGPP LSVEFHPLPP  240
GAWDDSTEPH YQGNIVVQDH QRMPKKMTEQ DARKMFRSEA FHTTCSSGVG SGYLSIPAGL  300
KYERASPKFE RASPKYEWAS YSKHEPLTSK STWRPANNHL QISDNYHVPD LNSSMQLDED  360
SPDESPSSGF VTKSYPAWHK QEAAGRLSSD AHLPLPYGSK NGTIPGKVLN AGKEFSVSRP  420
YNAGDIYHDA SGVNPNVKAA APLVQNRDLM SSQGEDKSQP KKMTKRERLR EERKIKKEQD  480
SALRLKQKLI PKEEKMIAQV ERKKQMEENR KPREVAKCQA ATEKVAISKN LMKGHTGEIP  540
SNFSGVGLVA ACSSME
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11217KKRRLK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1117590.0BT111759.1 Picea glauca clone GQ03303_E03 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0C9S8U30.0A0A0C9S8U3_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_3612_2671 transcribed RNA sequence
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.17e-35HB-other family protein