PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00020810-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family VOZ
Protein Properties Length: 540aa    MW: 60200.6 Da    PI: 8.1387
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00020810-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ105.37.4e-33471540170
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakv 70 
                       ppp+aflgpkcalwdc+rpaqg++w+qdycs fh tla neg+p ++p+lrp+gidlk g+lfaals+k+
  PSME_00020810-RA 471 PPPAAFLGPKCALWDCSRPAQGTKWFQDYCSDFHMTLASNEGAPRMRPILRPGGIDLKYGPLFAALSTKT 540
                       89*****************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.70.3306.8E-19333414IPR012677Nucleotide-binding alpha-beta plait domain
PfamPF087778.5E-13334412IPR014886La protein, RNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000166Molecular Functionnucleotide binding
GO:0003723Molecular FunctionRNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MQGPQLGLRS MTKDESKGDQ HCRNIKGGKD KGELYRLHAL VHALAALTFM RDVIIPVIVP  60
FSATALVLKD LILVRSKENI EKTLRHDLGN EPGMKNPIKL DIISTAKDES EGNQRCKKIK  120
GGKDKEGAKR EKLSFEKAVI EAIPEEVERN MLLPSPRSTR SFWFLVRIFF ETIHILFYYN  180
ILSKGRKTTS TSIQGVLRSY SIGLSVGSSK DSEEVSLSDD FFDEDKDESG GVGGGAPTRW  240
LEKGGYSRGC YHTAGQSSAY SSSFLLRRVH TDSSRGFFLT IKSQEEEGEQ YQIGRVFKSF  300
REMAGEKPKT GNVWNIVKPF VNGGASSMLA TCVIQPVDMI KYVDYHMGAE SGYVHFEQPE  360
MVQKPRAAAV LAEEGGLVVK NYIAVLEAVE GEAEKEYWAK LREGQDKRQQ FAGNSRGRVT  420
FWLCDFLVDD FHTPEKDFER DYIPAAKPIF SLTGKEETSP VFNGPQPGLC PPPAAFLGPK  480
CALWDCSRPA QGTKWFQDYC SDFHMTLASN EGAPRMRPIL RPGGIDLKYG PLFAALSTKT
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1187295e-83BT118729.1 Picea glauca clone GQ04009_K15 mRNA sequence.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-31vascular plant one zinc finger protein