PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00020311-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family TALE
Protein Properties Length: 440aa    MW: 49124.6 Da    PI: 6.7197
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00020311-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.36e-091231601954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+ +++  LA++ gLt +qV++WF N R +
  PSME_00020311-RA 123 FEHflHPYPKDADKHMLARQAGLTRSQVSNWFINARVR 160
                       554459******************************88 PP

2BELL94.31.1e-302571772
              BELL 17 eeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                      e+Vdk+Y+qy++q+q+v+ssFe+v+g g+ak YtslAl +iSrhFrcL+dai++qi
  PSME_00020311-RA  2 EMVDKKYRQYYQQMQIVVSSFETVTGFGTAKTYTSLALGTISRHFRCLRDAIVGQI 57
                      8******************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075263.5E-25154IPR006563POX domain
SMARTSM005741.1E-4155IPR006563POX domain
PROSITE profilePS5007111.872101164IPR001356Homeobox domain
CDDcd000862.30E-11104165No hitNo description
SMARTSM003894.5E-8104168IPR001356Homeobox domain
SuperFamilySSF466891.8E-16105171IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.2E-28107170IPR009057Homeodomain-like
PfamPF059201.0E-17121160IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MEMVDKKYRQ YYQQMQIVVS SFETVTGFGT AKTYTSLALG TISRHFRCLR DAIVGQICVS  60
SKSLGEEEMA GNGKGETSRL RFVDQQLRQQ RALQQLGMIQ QPAWRPQRGL PERAVSVLRA  120
WLFEHFLHPY PKDADKHMLA RQAGLTRSQV SNWFINARVR LWKPMVEEIY MEEMKEADLG  180
HSSAEKECKK SGESKADTKS GEGSENSQNS EDQNHTKAMQ IDTDAQDVVC EQQNISVSSG  240
LKSEHSLDMS YGRSQAFSIE GVSNDEVFHD LRDEDVTPGK LKKARNGIEG SPYHFSPNMS  300
TVVDFKMEES SRHGKFNDER HSSENYSLVH SGMVLADSSG SSGSYQIGCL NRYGQESFTP  360
KFSGNGGVSL TLGLQHSDGL SLSGTQQRCI SSEGRNRELG SVSHDYCNIS ETAAAHAANA  420
YESINSENRK RFATHLLQTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A5e-17110167158Homeobox protein Meis1
4xrs_B5e-17110167158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1137230.0BT113723.1 Picea glauca clone GQ03418_I09 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010059079.11e-122PREDICTED: BEL1-like homeodomain protein 1
TrEMBLA0A0C9RM181e-179A0A0C9RM18_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_11489_4138 transcribed RNA sequence
STRINGPOPTR_0006s21950.11e-122(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.26e-80BEL1-like homeodomain 6