PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00020272-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family HB-other
Protein Properties Length: 1353aa    MW: 153084 Da    PI: 8.0155
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00020272-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.25.1e-174296357
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                      kR+  t++q+e Le+++++++yp+++++ +LA +l Lte+qV  WF+ rR+kekk
  PSME_00020272-RA 42 KRRLKTRYQVEGLERFYAEEKYPTEAMKGKLAVELMLTEQQVHKWFCHRRQKEKK 96
                      79999*************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.41E-143598IPR009057Homeodomain-like
PROSITE profilePS5007115.2893797IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.8E-173896IPR009057Homeodomain-like
SMARTSM003897.4E-1739101IPR001356Homeobox domain
PfamPF000462.1E-144296IPR001356Homeobox domain
CDDcd000865.70E-144298No hitNo description
SMARTSM005717.2E-11549608IPR018501DDT domain
PROSITE profilePS5082714.011549608IPR018501DDT domain
PfamPF027914.5E-10550605IPR018501DDT domain
PfamPF050669.4E-8700768IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156125.9E-6872906IPR028942WHIM1 domain
PfamPF156131.6E-119901061IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1353 aa     Download sequence    Send to blast
FDITLQLYST QDFSARCSVA GDTNISIMGS VKDNIYLENN GKRRLKTRYQ VEGLERFYAE  60
EKYPTEAMKG KLAVELMLTE QQVHKWFCHR RQKEKKSKIN DTNSGGKQFR GVGLRKDGSR  120
KVKRLSISCL KRVENQMPLN IRNSRNPRSA ALGLELNDED VNPGNYNAID NIFVGINSSQ  180
ERSTLQNGSP CKMQSTRLRL QNGNRFKMQP NRSLRQRKNT GKIESKKRKR KSELATGQTY  240
VQEDAYDVAV TAVKSRLSGR FREDGPPLSI EYDPLPPGAF DSPLEPCCED ITASQDVQLM  300
PSKKKLGRSS HLPELHLIQP DIDSANKVPT SAFVTTGLQS GHNKFTAGRS GGKVLLPPRY  360
APLHAEIGNM DKEVHVTGDD VDPFPSVNTF KGNTDTYSGM PDEWQSNLLS VQGEDEVQPK  420
YMTMREKNQE KDLQKKRGYV LKLKWNVFQE EKRPQSQREV CKSLKQRDGA KITAARKRNL  480
KKQSRKPEKL IEDECLEMRE LQITSNVGVE MDETGRLNSK YHEGLPGRFP PASLRMKQLC  540
LAHPWKDSKE NVRNLFMVFR FLYTLSDVIN LCPFTLDEFL QAFHVHESKL LGQIHIALLK  600
LLLEDVEIEL QSSVSTGKLT QCDSALSDCS FLRLTQAVKR RSFNVKVWKE FLNPLTWPEI  660
LRQVVMDAGF CPKRKKEMEI LSKTADKEGS QTGYHGLVPG TLKCALFRIL SKEGTNGLKI  720
SEIAKHVQNC DLNDLPSSNA LEALICSSLS SDITLFERIS SSAFRLRANF IHSRDGDHSC  780
SETSGDMESD TVESDSEESD TGESAESAYE EQVIAHAPET GREGIYTGIP PALPPPRECR  840
SQHDAIVGLR NEGNEVDRHC IDGTEIDESH VGDAWVLGLM EGEYADLSVE EKLNALVALF  900
NLVNSGNIVQ RTIKDPSRMA SQFHSQVELH RIGNKQGRDK STAAKKPSSV NTSRKTSKKR  960
KRDRVYLKLS DLDSKSQASD PYCPESFSTQ SICLGSDRRH NTYWQFFGGS LRDPGCGRVY  1020
FESSDDGHWE VIDNEEALDT LMALLDSRGV REVNLLSSLR SRGTLLRQEM RKPKSGVNQE  1080
SGKYGREILS GDSSSGASII ENNQNDTVFE PENDSSVLSG AISLQFGGTE VENQHDWDHY  1140
RAFDRWVWGD FFQTLKVLKC NADRLLPCES CHDLYWPEEE HCMLCHTTFE LDFDSEERYA  1200
VHVAKCKGRG HDESIRRCKV LSSRLQSLKA GMQAVEAVLP QEALEASWKK SGQKVWIKHL  1260
RRASSPTELA EVLTDLQNAI RDDWLLRSQS ACREMLPFFP FTPQTTASMS FWLIRLDALI  1320
SVNWEKTSPK DARQRRIRSK GVFMPFVHKM LLP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1225230KKRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.16e-85Homeodomain-like transcriptional regulator