PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00020027-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family VOZ
Protein Properties Length: 480aa    MW: 53727.8 Da    PI: 6.1477
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00020027-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ362.12e-1112714737217
               VOZ   7 lgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdls 99 
                        gpkcalwdc+ paqg++w+qd+cs fh tla neg+p ++pvlrp+gidlkdg+lfaal        +gipecegaatakspwna elfd+ 
  PSME_00020027-RA 271 TGPKCALWDCSTPAQGTKWCQDHCSDFHMTLASNEGAPRMRPVLRPGGIDLKDGPLFAAL--------IGIPECEGAATAKSPWNAYELFDMY 355
                       69*********************************************************9........7************************ PP

               VOZ 100 llegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvde 192
                       +lege++rewlffdkprrafesgnrkq sl dysgrgwhesrkqv k+fgglkrsyymdpqps++fewhlyeyein++da+alyrlelk+v +
  PSME_00020027-RA 356 VLEGESMREWLFFDKPRRAFESGNRKQCSLRDYSGRGWHESRKQVTKDFGGLKRSYYMDPQPSTQFEWHLYEYEINDCDACALYRLELKMVCS 448
                       ********************************************************************************************* PP

               VOZ 193 kksakgkvskdsladlqkklgrlta 217
                       kk++kgkv  d+l+dlq++lg+l+a
  PSME_00020027-RA 449 KKNTKGKVGGDPLVDLQHQLGKLSA 473
                       ***********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.70.3301.6E-1086144IPR012677Nucleotide-binding alpha-beta plait domain
PfamPF087772.3E-587144IPR014886La protein, RNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000166Molecular Functionnucleotide binding
GO:0003723Molecular FunctionRNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
GALQHTAGQS SAYSSSFLLR RVQTDSSRGF FLTIRSQEEE GEQYQIGRVF KSFREMAGEK  60
PKKSNVWNTV KPFVNGGASG MLTTCVIQPV DMIKYVDYHM GAESGYVRFE QPEMVQKPRA  120
AAVLAEEGGL VVKNYIAVLE AVEGMCTFFC GCVVKLGRNT GLSSVKVKIS VGNLQATDFL  180
VDDFHTLEKD FERVSRCTNI GEGLHQNSYP QTSVQLPANI EHQENNNYVQ TSEQLPPNLV  240
EGLEVTSGLE GGQINFHQDY IPAAQPIFTL TGPKCALWDC STPAQGTKWC QDHCSDFHMT  300
LASNEGAPRM RPVLRPGGID LKDGPLFAAL IGIPECEGAA TAKSPWNAYE LFDMYVLEGE  360
SMREWLFFDK PRRAFESGNR KQCSLRDYSG RGWHESRKQV TKDFGGLKRS YYMDPQPSTQ  420
FEWHLYEYEI NDCDACALYR LELKMVCSKK NTKGKVGGDP LVDLQHQLGK LSADFSWVEK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1185316e-73BT118531.1 Picea glauca clone GQ04007_G03 mRNA sequence.
GenBankEF6772866e-73EF677286.1 Picea sitchensis clone WS02764_M18 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011626288.11e-116transcription factor VOZ1
RefseqXP_011626289.11e-116transcription factor VOZ1
SwissprotQ9SGQ01e-108VOZ1_ARATH; Transcription factor VOZ1
TrEMBLW1Q0P11e-115W1Q0P1_AMBTC; Uncharacterized protein
STRINGERN140211e-116(Amborella trichopoda)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-110vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]