PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00019013-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family VOZ
Protein Properties Length: 404aa    MW: 44815.1 Da    PI: 5.2979
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00019013-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ116.13.6e-362102981101
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                       ppp aflgpkcalwdc+rpaqg +w+qdycs+fh ++alne            gidlkdgllfa+l ak+  k+ gip+cegaat+kspwna+
  PSME_00019013-RA 210 PPPKAFLGPKCALWDCPRPAQGPDWCQDYCSNFHGMVALNE------------GIDLKDGLLFATLGAKTMVKSFGIPKCEGAATKKSPWNAP 290
                       89*************************************98............79************************************** PP

               VOZ  94 elfdlsll 101
                       e+ + ++l
  PSME_00019013-RA 291 EVNEKAVL 298
                       *9887665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031411.4E-35320404IPR004159Putative S-adenosyl-L-methionine-dependent methyltransferase
SuperFamilySSF533353.26E-6331403IPR029063S-adenosyl-L-methionine-dependent methyltransferase
Gene3DG3DSA:3.40.50.1502.9E-4336403IPR029063S-adenosyl-L-methionine-dependent methyltransferase
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008168Molecular Functionmethyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MMGKRSKSMP KSITHQLFKT KAKNRGMFND LQQVRKESRV NDALVLEEHV HQLPWECKAE  60
LHEESPTTSM LEASLCLSDL SCDMWRLLQL HEEEDDATNI IVAPYSSKLQ LNENTLEAAN  120
PSSFQEAIPP NEMRKDFYVD HANAEAQNID GTSRSENIHT ESLLQNTDES LEAAAQMNRY  180
FDNNLCLSLD PKVEEEHMPK FQGPCPGISP PPKAFLGPKC ALWDCPRPAQ GPDWCQDYCS  240
NFHGMVALNE GIDLKDGLLF ATLGAKTMVK SFGIPKCEGA ATKKSPWNAP EVNEKAVLLQ  300
AAALPGMVNP MEESVAPLPE KMVPNVAWGV HTRVGLDVGC GVAIFGAFFL SRNVSTLSIV  360
SKDVHENQIQ FSLERGVPAM VAAFATRRLL YPSQAFEMIH CSRC
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021660497.13e-76transcription factor VOZ1-like
SwissprotQ9SGQ01e-68VOZ1_ARATH; Transcription factor VOZ1
TrEMBLB9S9361e-73B9S936_RICCO; Uncharacterized protein
STRINGXP_002522505.12e-74(Ricinus communis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.24e-71vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]