PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00018790-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family HB-other
Protein Properties Length: 161aa    MW: 18457.7 Da    PI: 9.8353
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00018790-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox21.34.6e-079451753
                      HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
          Homeobox 17 elFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53
                      ++F+kn  ps   +  L+k+l+L+ rqV +W +N R+
  PSME_00018790-RA  9 QVFAKNELPSIPCKLVLSKQLDLPYRQVHMWLKNARY 45
                      58*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000867.23E-5251No hitNo description
SuperFamilySSF466892.22E-7854IPR009057Homeodomain-like
PfamPF000461.4E-4945IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.8E-61060IPR009057Homeodomain-like
PROSITE profilePS500718.7781150IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MPMQLMFCQV FAKNELPSIP CKLVLSKQLD LPYRQVHMWL KNARYMSLKK KNMNRLKESA  60
TPVISSNTRR LKVESSKSTP QIKEPDDVGN SYLTEMEKLG NIELKLESLR KILETVCPKE  120
GADFSNDKNP EGTSNLLSEK LLMYVPIMDL REKSLQVAPA R
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.11e-07pathogenesis related homeodomain protein A