PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00017336-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family VOZ
Protein Properties Length: 314aa    MW: 35381 Da    PI: 4.9923
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00017336-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ147.68.6e-4634126193
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                       pp  aflgpkcalwdc+rpaqg +w+qdycs+fh ++alneg+pg+ pvl+p+gidlkdgllf al ak+  k+ gipecegaat+kspwn +
  PSME_00017336-RA  34 PPFEAFLGPKCALWDCPRPAQGLDWCQDYCSNFHGMVALNEGSPGMGPVLQPGGIDLKDGLLFTALGAKTVVKSFGIPECEGAATKKSPWNVP 126
                       66789**************************************************************************************76 PP

2VOZ133.22.2e-41125203129207
               VOZ 129 lpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakgkvskdslad 207
                       +pdy+grgwhesrkqvmke gg+krsyymdpqps++fewhlyeye+n++d++aly lelk+vd+kk++k kv+ d ++ 
  PSME_00017336-RA 125 VPDYNGRGWHESRKQVMKEIGGMKRSYYMDPQPSNQFEWHLYEYEMNNCDSCALYWLELKQVDSKKNTKEKVMGDYVNT 203
                       7************************************************************************998875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MNRDFDQNLC LSLDPEVEEE HIPKFQGPCP GIYPPFEAFL GPKCALWDCP RPAQGLDWCQ  60
DYCSNFHGMV ALNEGSPGMG PVLQPGGIDL KDGLLFTALG AKTVVKSFGI PECEGAATKK  120
SPWNVPDYNG RGWHESRKQV MKEIGGMKRS YYMDPQPSNQ FEWHLYEYEM NNCDSCALYW  180
LELKQVDSKK NTKEKVMGDY VNTEKDHIIC EDSRSKVVVE DAYLEPQYSQ TLHLRLVKGN  240
ATCGISNDHQ QDGPYPNVLA PPEHIIPCVE HLKMSVDVFR LLPSNAHNTT RLEGISCLLK  300
ESHNSLQVSK ADED
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1069633e-46BT106963.1 Picea glauca clone GQ03101_E12 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008383671.12e-90transcription factor VOZ1
RefseqXP_008383672.12e-90transcription factor VOZ1
SwissprotQ9SGQ03e-83VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A0A0KI668e-89A0A0A0KI66_CUCSA; Uncharacterized protein
STRINGXP_008383671.16e-90(Malus domestica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-85vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]