PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00017162-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family VOZ
Protein Properties Length: 144aa    MW: 16213.8 Da    PI: 5.6634
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00017162-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ173.97.4e-54341441111
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                       ppp aflgpkcalwdc+rpaqgs w+qdyc +fh ++a neg++g+ pvlrp+gidlkd llfaalsak+  k  gipecegaat+kspwna+
  PSME_00017162-RA  34 PPPKAFLGPKCALWDCPRPAQGSYWCQDYCRNFHRMVAWNEGPLGMGPVLRPGGIDLKDVLLFAALSAKTVVKYFGIPECEGAATKKSPWNAP 126
                       89******************************************************************************************* PP

               VOZ  94 elfdlsllegetirewlf 111
                       elfdl +l+ e ir  lf
  PSME_00017162-RA 127 ELFDLFVLQEEFIRVALF 144
                       **************8887 PP

Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MNRYFDHNLC LSLDPEVEEE HIPKFQGPCP GISPPPKAFL GPKCALWDCP RPAQGSYWCQ  60
DYCRNFHRMV AWNEGPLGMG PVLRPGGIDL KDVLLFAALS AKTVVKYFGI PECEGAATKK  120
SPWNAPELFD LFVLQEEFIR VALF
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010657013.13e-56PREDICTED: transcription factor VOZ1
RefseqXP_019079230.13e-56PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ01e-51VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A2K3NRV05e-55A0A2K3NRV0_TRIPR; Transcription factor VOZ1-like protein
TrEMBLA5CA221e-54A5CA22_VITVI; Uncharacterized protein
TrEMBLF6H4X22e-54F6H4X2_VITVI; Uncharacterized protein
STRINGVIT_12s0028g02670.t014e-55(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.25e-54vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]