PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00014997-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family VOZ
Protein Properties Length: 614aa    MW: 69377.3 Da    PI: 5.6513
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00014997-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ405.79.6e-1253505661217
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                       ppp+aflgpkcalwdc+rpaqg++w+qdycs fh tla neg+pg++pvlrp+gidlkdg+lfaalsak+q k vgipecegaatakspwna 
  PSME_00014997-RA 350 PPPAAFLGPKCALWDCSRPAQGTKWCQDYCSDFHMTLASNEGAPGMRPVLRPEGIDLKDGPLFAALSAKTQEKAVGIPECEGAATAKSPWNAY 442
                       89******************************************************************************************* PP

               VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrle 186
                       elfd+ +lege++rew+ffdk +r fesgn+kqrslpdysgrgwhesrkqv+k+fgglkrsyymdpqps++fewhlyeyein++da+alyrle
  PSME_00014997-RA 443 ELFDMYVLEGESMREWFFFDKLQRDFESGNQKQRSLPDYSGRGWHESRKQVIKDFGGLKRSYYMDPQPSTQFEWHLYEYEINDCDACALYRLE 535
                       ********************************************************************************************* PP

               VOZ 187 lklvdekksakgkvskdsladlqkklgrlta 217
                       lk+v +kk++kgkv  d+l+dlq++lg+l+a
  PSME_00014997-RA 536 LKMVYSKKNTKGKVGGDPLVDLQHQLGKLSA 566
                       *****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.70.3304.0E-4168198IPR012677Nucleotide-binding alpha-beta plait domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000166Molecular Functionnucleotide binding
Sequence ? help Back to Top
Protein Sequence    Length: 614 aa     Download sequence    Send to blast
MRNCSWEFIR ENSMVYRRYF IRNSMSWKSS DRVCEEGTIG KCPDIVAEIP YRECGFKESL  60
QKGGKRDGSS SMDSIFVQMG SDRRYFHGLT RSDVPISKVP FSVVPVFATG SHFPTFGSVP  120
MGYETESFTG TGSLSGSLYI DRRRIEVLKS PILYVDSRPG LLFEYDNYVD YHMGAESGYV  180
RFEQPEMVQK PRAAAVVSKI VEACRFDEFT DIVVVTRHGI KDKKVVGTMS EAYPHIIIHI  240
FSTKDFLVDD LHTPEKYFER VSRCTNIGEG LHQNSYPQTS EQLPANIEHQ ENNNYVQTSE  300
QLPPNLVEGL EVTSGLEGGQ INFHQDYIPA AQPIFTLTGE EETSPPGLCP PPAAFLGPKC  360
ALWDCSRPAQ GTKWCQDYCS DFHMTLASNE GAPGMRPVLR PEGIDLKDGP LFAALSAKTQ  420
EKAVGIPECE GAATAKSPWN AYELFDMYVL EGESMREWFF FDKLQRDFES GNQKQRSLPD  480
YSGRGWHESR KQVIKDFGGL KRSYYMDPQP STQFEWHLYE YEINDCDACA LYRLELKMVY  540
SKKNTKGKVG GDPLVDLQHQ LGKLSAEFSW NGSNYTYSAS TQVAPIGKNL LMGHECSMVI  600
LSKKQVDAMQ LNDK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-121vascular plant one zinc finger protein