PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00014706-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family M-type_MADS
Protein Properties Length: 244aa    MW: 27923.2 Da    PI: 10.4937
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00014706-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.34e-28958150
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                      krien +nrqvtfskRrng+lKKA+ELSvLCda   ++ifs++gklye++
  PSME_00014706-RA  9 KRIENATNRQVTFSKRRNGLLKKAYELSVLCDAPMGLMIFSPRGKLYEFA 58
                      79***********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.333161IPR002100Transcription factor, MADS-box
SMARTSM004322.7E-37160IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-28323IPR002100Transcription factor, MADS-box
CDDcd002657.96E-35360No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.59E-26361IPR002100Transcription factor, MADS-box
PfamPF003196.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MLRGKTLMKR IENATNRQVT FSKRRNGLLK KAYELSVLCD APMGLMIFSP RGKLYEFANP  60
RIAIHVVCVG EMIPSDSKSR EASKCQGITG VETPLKTTQA MQSLPFFPCK VKFEDPLPKL  120
NEKHDTFNGK YRQYGAVLNH QETTNGHFFQ SITKKKKLDN TYSSAPSEWL SGRHPGELEV  180
ERQRKLTRGK VVEDQLVCPK FEEIQRDNLP RYKAGKDHVV KATIKKKSKS SKYRKINNNT  240
DFQA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1145880.0BT114588.1 Picea glauca clone GQ03517_I06 mRNA sequence.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.15e-30AGAMOUS-like 20