PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00014530-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family M-type_MADS
Protein Properties Length: 404aa    MW: 46130.5 Da    PI: 6.5039
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00014530-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF43.83.3e-141251443
                      -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
            SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                        ++ r+ tf kR+ g+ KK eELS+LC++e++++ f+++
  PSME_00014530-RA 12 PRDTSRNMTFMKRKRGLKKKVEELSILCGVEACMVCFGPQ 51
                      56789********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.6E-14160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.829149IPR002100Transcription factor, MADS-box
CDDcd002661.53E-23291No hitNo description
SuperFamilySSF554557.85E-202102IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-9323IPR002100Transcription factor, MADS-box
PfamPF003197.0E-151351IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MGRAKIPIKW IPRDTSRNMT FMKRKRGLKK KVEELSILCG VEACMVCFGP QMDQQTASDH  60
PDVWPEKLKA LEIVERYRSL SKEEQEKKKL DNSSFLEQRI KKLKVELSIK RKENRELEME  120
AVYPWDTCLN FFTDEQLRDL VDYIDIRLET VHDRINFLSR HEREIPNGAE NDMVPLKELE  180
CIARQPMECG GSYNFMMPYQ SGDESLSSTM GHVKPYLGLE GHYKALMSSC GTAAMDYHSK  240
ANPLFITALK DYHAPNSNEA MGNGEEDRIA VSNAHLMVNK SFPLLGIDGV NHIQSSTGSC  300
SQWCCTITPC SLQNPLYSTC PQHYGMNPTV QQVQFSYEPH HQQWLNEMME SQTIQKVLGD  360
EGTNFTNNSS VGPPPLLLSR SSGNNDHCHI KNIQGFLLSY NLFF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1245670.0BT124567.1 Picea sitchensis clone WS0475_C11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB2ZX881e-103B2ZX88_CRYJA; Type I MADS-box transcription factor
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.12e-20AGAMOUS-like 38