PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00013889-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family HB-other
Protein Properties Length: 102aa    MW: 11864.8 Da    PI: 10.3539
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00013889-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.54.7e-0810501353
                      HHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
          Homeobox 13 eeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53
                      e+  ++F+ +  ps   +  L+k+l+L+ + V +WF+N R+
  PSME_00013889-RA 10 ERFCQVFADKELPSMPYKLVLSKQLDLPYQHVHMWFKNARY 50
                      566689999*******************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.588155IPR001356Homeobox domain
SuperFamilySSF466891.97E-7562IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.1E-7757IPR009057Homeodomain-like
PfamPF000461.4E-51050IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
MSKLPTNAVE RFCQVFADKE LPSMPYKLVL SKQLDLPYQH VHMWFKNARY MSLKKKKLNR  60
LKESAAPVIS TNTRRLKLES SNSTPQIKET DDASNSYLTK ME
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.22e-14pathogenesis related homeodomain protein A