PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00013862-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family VOZ
Protein Properties Length: 274aa    MW: 30336.4 Da    PI: 5.7885
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00013862-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ140.99.7e-44186274189
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaataksp 89 
                       ppp aflgpkcalwdc+rpaqgs+w+qdycs+fh ++alneg+pg+ pvlrp+gi+lkdgllfaal ak+  k+ gipe egaat+ksp
  PSME_00013862-RA 186 PPPKAFLGPKCALWDCPRPAQGSDWCQDYCSNFHGMVALNEGPPGMGPVLRPGGINLKDGLLFAALGAKTVVKSFGIPEREGAATKKSP 274
                       89**************************************************************************************9 PP

Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MMEKRSKSMP KSTTHKLFKT KAKNRVHQLP WECKAELHEE SPTTSMLEAS LCSSDLSCDM  60
WRLLQLHEEE DDATSILVAP YISKLHLNEN TLEAANPSSF QEAIPPNEMR KDFYVDHANA  120
ESQNIDGTSR SENIHTESLL QTTYEGLEAA AQMNRYFDHN LCLSLDPKVE EDHIPKFQGP  180
CPGISPPPKA FLGPKCALWD CPRPAQGSDW CQDYCSNFHG MVALNEGPPG MGPVLRPGGI  240
NLKDGLLFAA LGAKTVVKSF GIPEREGAAT KKSP
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021660497.16e-72transcription factor VOZ1-like
SwissprotQ9SGQ09e-64VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A438EGC16e-70A0A438EGC1_VITVI; Transcription factor VOZ1
STRINGevm.model.supercontig_7.62e-69(Carica papaya)
STRINGXP_002522505.13e-69(Ricinus communis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.24e-66vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]