PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00013164-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family M-type_MADS
Protein Properties Length: 214aa    MW: 23728.1 Da    PI: 10.0627
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00013164-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.48.9e-29958150
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                      krien + rqvtfskRrng+lKKA+ELSvLCdaev ++ifs++g+lye++
  PSME_00013164-RA  9 KRIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVGLMIFSPRGNLYEFA 58
                      79***********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.74161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.58E-27366IPR002100Transcription factor, MADS-box
CDDcd002658.71E-38361No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-29323IPR002100Transcription factor, MADS-box
PfamPF003196.8E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MVRGKTLMKR IENATSRQVT FSKRRNGLLK KAYELSVLCD AEVGLMIFSP RGNLYEFANP  60
SEAPLAWYSR VGPSQTARRV TAGNSADNLP ETGNRRNSSK LAATRRNREY SPELAVLTSE  120
CGVEFTAFAA AGGGVHGHRW DKQLHSPLHA LGAYLNPSLF YNLDSSIKGD LEVMRGVMIC  180
IEKMFLNPTI QDKINLQRDM YKAASGMFGF SSTQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1113018e-49BT111301.1 Picea glauca clone GQ03235_L08 mRNA sequence.
GenBankHQ1765218e-49HQ176521.1 Picea abies MADS-domain transcription factor dal3 variant 2 (DAL3) mRNA, complete cds, alternatively spliced.
GenBankX792818e-49X79281.1 P.abies dal3 mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLQ407676e-32Q40767_PICAB; DAL3 protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.17e-33AGAMOUS-like 14