PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00007305-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family M-type_MADS
Protein Properties Length: 282aa    MW: 31504.2 Da    PI: 6.4556
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00007305-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF885.2e-28958150
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                      k+ien++nrqvtfskRrng++KKA+ELS+LCd+++a+i+fs++g+l  +s
  PSME_00007305-RA  9 KKIENSTNRQVTFSKRRNGLIKKAYELSILCDIDIALIMFSPSGRLSQFS 58
                      68********************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.1E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.758161IPR002100Transcription factor, MADS-box
CDDcd002653.02E-36258No hitNo description
SuperFamilySSF554551.57E-26261IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGRVKLQIKK IENSTNRQVT FSKRRNGLIK KAYELSILCD IDIALIMFSP SGRLSQFSGK  60
KRCLEADPLM ITSVEQADYY ERMLEESLHR VRLRKLYMQQ STNPNGASTS DNQLIHWLPQ  120
RDPQTSVPNF LDSNSMLTIR ECVEECMPNG VVFTGHPQER HGNFQLGSHA SDHSSPAHMR  180
FDYTTLEGDA GNHDHHQHHH HHMGEYGSTV GLAPSQWEPS YAVAAGGLMP SMGMMENVTG  240
IMSQQQEESS SHGALSTPQD DVGIDVSFQS NVGDHVTGPD CR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P6e-18181177Myocyte-specific enhancer factor 2B
1tqe_Q6e-18181177Myocyte-specific enhancer factor 2B
1tqe_R6e-18181177Myocyte-specific enhancer factor 2B
1tqe_S6e-18181177Myocyte-specific enhancer factor 2B
6c9l_A6e-18181177Myocyte-specific enhancer factor 2B
6c9l_B6e-18181177Myocyte-specific enhancer factor 2B
6c9l_C6e-18181177Myocyte-specific enhancer factor 2B
6c9l_D6e-18181177Myocyte-specific enhancer factor 2B
6c9l_E6e-18181177Myocyte-specific enhancer factor 2B
6c9l_F6e-18181177Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010064162.13e-35PREDICTED: agamous-like MADS-box protein AGL104
TrEMBLA5BY191e-47A5BY19_VITVI; Uncharacterized protein
STRINGXP_010105468.17e-46(Morus notabilis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.11e-32AGAMOUS-like 104