PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00005649-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family HB-other
Protein Properties Length: 251aa    MW: 28717.2 Da    PI: 10.5998
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00005649-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.33.5e-1091135953
                       HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
          Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                       ++ +e+  ++F++n  ps + +  L+k+l+Lt rqV +WF+N R+
  PSME_00005649-RA  91 ANAVERFRQVFAENELPSMSCKLVLSKQLDLTYRQVHMWFKNARY 135
                       567888999**********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.99E-1176139IPR009057Homeodomain-like
PROSITE profilePS5007112.68180140IPR001356Homeobox domain
SMARTSM003893.3E-882144IPR001356Homeobox domain
CDDcd000861.43E-683141No hitNo description
Gene3DG3DSA:1.10.10.601.2E-1183150IPR009057Homeodomain-like
PfamPF000461.0E-791135IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MVYSSSNSEQ KMEMPRNEKS NETNLMGEGV VGPKKKIPKE KKAESASLIS SVRVENKSRN  60
TKRKHRRKNI KTPLSISSRN ESKRTMSRLP ANAVERFRQV FAENELPSMS CKLVLSKQLD  120
LTYRQVHMWF KNARYMSLKK KKMNRLKESA APVISANTRR LKVESSKSTP QIKEPDDAGN  180
SYLTEMEKLG NIEFKLESLR KILETFCPKE GADLSNDKNP EGIANLLSEE LLMYVPVVEL  240
REKSLQVAPV R
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.17e-16pathogenesis related homeodomain protein A