PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00005210-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family HB-other
Protein Properties Length: 166aa    MW: 19230.2 Da    PI: 6.2837
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00005210-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.83.8e-088501153
                      HHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
          Homeobox 11 qleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53
                       +e+  ++F +n  ps   +  L+k+l+L+ + V +WF+N R+
  PSME_00005210-RA  8 AVERFRQVFVENELPSMPYKPVLSKQLDLPYQHVHMWFKNARY 50
                      67788999*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.608155IPR001356Homeobox domain
CDDcd000860.00189256No hitNo description
Gene3DG3DSA:1.10.10.601.9E-7349IPR009057Homeodomain-like
SuperFamilySSF466897.7E-8458IPR009057Homeodomain-like
PfamPF000461.1E-5850IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MSRLPTNAVE RFRQVFVENE LPSMPYKPVL SKQLDLPYQH VHMWFKNARY MSLKKKNLNH  60
LKESVAPIIY ANTRRLKVES SKSTSQIKEP DDASNSYLTE MEELGNIELK LEILRNILET  120
VCPEEGVDFS NDKNPEGITN LLSEELLMYV PVVELREKIL QVAPAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.13e-15pathogenesis related homeodomain protein A