PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00004294-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family VOZ
Protein Properties Length: 486aa    MW: 53985.1 Da    PI: 5.0357
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00004294-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ396.94.7e-1221713871217
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                       ppp+aflgpkcalwdc+rpaqg +w+qdycs fh t+a neg+pg++ vlrp+gidlkdg+lf+alsak+q k vgipecegaatakspwna 
  PSME_00004294-RA 171 PPPAAFLGPKCALWDCSRPAQGKKWCQDYCSDFHMTVASNEGAPGMRHVLRPGGIDLKDGPLFDALSAKTQEKAVGIPECEGAATAKSPWNAY 263
                       89******************************************************************************************* PP

               VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrle 186
                       elfd+ +lege++rewlffdkpr+ fesgnrkq slpdysg gwhesrkqv+k+fgglkrsyy+dpqps++few+lyeyein++da+alyrle
  PSME_00004294-RA 264 ELFDMYVLEGESMREWLFFDKPRQDFESGNRKQCSLPDYSGCGWHESRKQVIKDFGGLKRSYYIDPQPSTQFEWNLYEYEINDCDACALYRLE 356
                       ********************************************************************************************* PP

               VOZ 187 lklvdekksakgkvskdsladlqkklgrlta 217
                       lk+v +kk+akgkv  d+l+dlq++lg+l+a
  PSME_00004294-RA 357 LKMVCSKKNAKGKVGGDPLVDLQHQLGKLSA 387
                       *****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.70.3302.8E-480110IPR012677Nucleotide-binding alpha-beta plait domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000166Molecular Functionnucleotide binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MFRSDVPKSK VPFSVVPVFA TGSHFPTFGS VPMGYETESF TGTGSLSGSL YIDRWRIEVP  60
KSPILYVDSR PGLLFEYDNY VDYHMGAESG YVRFEQPEMV QKPRAAAVLA EDGGEQLPPN  120
LVEGLEVTSG LEGGQINFHQ DYIPAAQPIF TLTGEEETSP VFNGPHPGLC PPPAAFLGPK  180
CALWDCSRPA QGKKWCQDYC SDFHMTVASN EGAPGMRHVL RPGGIDLKDG PLFDALSAKT  240
QEKAVGIPEC EGAATAKSPW NAYELFDMYV LEGESMREWL FFDKPRQDFE SGNRKQCSLP  300
DYSGCGWHES RKQVIKDFGG LKRSYYIDPQ PSTQFEWNLY EYEINDCDAC ALYRLELKMV  360
CSKKNAKGKV GGDPLVDLQH QLGKLSAEFS WNGSNYTYSA STQVAPIGKS LLMGHECSMV  420
ILSKKQVDAM KLNDKRALTK YSTLYNYSVY FKEMIDALAT ISNAIIKGIM ESDANAFAPF  480
QQASCY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010260370.11e-128PREDICTED: transcription factor VOZ1
TrEMBLA0A1U8A0G41e-126A0A1U8A0G4_NELNU; transcription factor VOZ1
STRINGXP_010260370.11e-127(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-118vascular plant one zinc finger protein