PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00001983-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family VOZ
Protein Properties Length: 319aa    MW: 35789.3 Da    PI: 5.0894
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00001983-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ404.71.9e-124963121217
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                       ppp+aflgpkc+lwdc+rpaqg++w+qdycs fh tla neg+pg++pvlrp+gidlkdg+lfaalsak+q k vgipecega+takspwna 
  PSME_00001983-RA  96 PPPAAFLGPKCTLWDCSRPAQGTKWCQDYCSDFHMTLASNEGAPGMRPVLRPGGIDLKDGPLFAALSAKTQEKAVGIPECEGAVTAKSPWNAY 188
                       89******************************************************************************************* PP

               VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrle 186
                       elfd+ +lege++rewlffdk r afesgnrkqrs+pdysgrgwhesrkqv+k+fgglkrsyymdpqps++fewhlyeyein++da+a yrle
  PSME_00001983-RA 189 ELFDMYVLEGESMREWLFFDKLRWAFESGNRKQRSFPDYSGRGWHESRKQVIKDFGGLKRSYYMDPQPSTQFEWHLYEYEINDCDACAPYRLE 281
                       ********************************************************************************************* PP

               VOZ 187 lklvdekksakgkvskdsladlqkklgrlta 217
                       lk+v +kk++kgkv  d+l+dlq++lg+l+a
  PSME_00001983-RA 282 LKTVCSKKNTKGKVGGDPLVDLQHQLGKLSA 312
                       *****************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MATCTNIGEG LHQNSYPQTS VQLPTNIEHQ ENNNYVQTSE QLPPNLVEGL EVTFGLEGGQ  60
INFHQDYIPT AKPIFTLTGE EETSPIFNGP QPGLCPPPAA FLGPKCTLWD CSRPAQGTKW  120
CQDYCSDFHM TLASNEGAPG MRPVLRPGGI DLKDGPLFAA LSAKTQEKAV GIPECEGAVT  180
AKSPWNAYEL FDMYVLEGES MREWLFFDKL RWAFESGNRK QRSFPDYSGR GWHESRKQVI  240
KDFGGLKRSY YMDPQPSTQF EWHLYEYEIN DCDACAPYRL ELKTVCSKKN TKGKVGGDPL  300
VDLQHQLGKL SAEFSWVAK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010260370.11e-132PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ01e-121VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A1U8A0G41e-130A0A1U8A0G4_NELNU; transcription factor VOZ1
STRINGXP_010260370.11e-131(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-123vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]