PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00001749-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family M-type_MADS
Protein Properties Length: 83aa    MW: 9387.97 Da    PI: 9.923
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00001749-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.22.6e-292070151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      k+i++ + rqvtfskR+ gi+KKA+ELSvLCdaevav+ifs+tg+lyey+s
  PSME_00001749-RA 20 KKIDDVTSRQVTFSKRKSGIFKKANELSVLCDAEVAVLIFSNTGRLYEYAS 70
                      689**********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554554.32E-291273IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.9171272IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-391271IPR002100Transcription factor, MADS-box
CDDcd002652.06E-351371No hitNo description
PROSITE patternPS0035001468IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-281434IPR002100Transcription factor, MADS-box
PfamPF003196.9E-262168IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-283449IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-284970IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
MKGIQTDRDV IMGRGKIEIK KIDDVTSRQV TFSKRKSGIF KKANELSVLC DAEVAVLIFS  60
NTGRLYEYAS SRYIQRPSLI CPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-191271160Myocyte-specific enhancer factor 2B
1tqe_Q1e-191271160Myocyte-specific enhancer factor 2B
1tqe_R1e-191271160Myocyte-specific enhancer factor 2B
1tqe_S1e-191271160Myocyte-specific enhancer factor 2B
5f28_A1e-191271160MEF2C
5f28_B1e-191271160MEF2C
5f28_C1e-191271160MEF2C
5f28_D1e-191271160MEF2C
6c9l_A1e-191271160Myocyte-specific enhancer factor 2B
6c9l_B1e-191271160Myocyte-specific enhancer factor 2B
6c9l_C1e-191271160Myocyte-specific enhancer factor 2B
6c9l_D1e-191271160Myocyte-specific enhancer factor 2B
6c9l_E1e-191271160Myocyte-specific enhancer factor 2B
6c9l_F1e-191271160Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1073021e-104BT107302.1 Picea glauca clone GQ03105_H22 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012086200.13e-29MADS-box transcription factor 23 isoform X2
RefseqXP_012086201.23e-29MADS-box transcription factor 23 isoform X1
SwissprotQ6VAM49e-29MAD23_ORYSJ; MADS-box transcription factor 23
TrEMBLA0A0K0M6Z42e-37A0A0K0M6Z4_PINTB; DAL21 (Fragment)
STRINGOS04T0461300-012e-28(Oryza sativa)
STRINGXP_010482531.19e-28(Camelina sativa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51860.24e-30MIKC_MADS family protein
Publications ? help Back to Top
  1. Puig J, et al.
    Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice.
    Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70
    [PMID:23466806]
  2. Yu C, et al.
    The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice.
    PLoS ONE, 2014. 9(8): p. e105597
    [PMID:25140876]
  3. Wang H, et al.
    A Signaling Cascade from miR444 to RDR1 in Rice Antiviral RNA Silencing Pathway.
    Plant Physiol., 2016. 170(4): p. 2365-77
    [PMID:26858364]