PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00000683-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family TALE
Protein Properties Length: 214aa    MW: 24617 Da    PI: 9.6672
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00000683-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.68.6e-081241572154
                       HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       k +yp+++e+++L +++gL+ +q+ +WF N+R +
  PSME_00000683-RA 124 KWPYPTEDEKARLVQETGLQLKQINNWFINQRKR 157
                       469*****************************87 PP

2ELK25.82.4e-097899122
               ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                      ELK  L+++Y+ ++ ++++E++
  PSME_00000683-RA 78 ELKVDLKQGYKAKIADVREEIL 99
                      9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512139.2197898IPR005539ELK domain
PROSITE profilePS5007111.62998161IPR001356Homeobox domain
SMARTSM003893.2E-10100165IPR001356Homeobox domain
SuperFamilySSF466898.55E-16100164IPR009057Homeodomain-like
CDDcd000863.84E-10101162No hitNo description
Gene3DG3DSA:1.10.10.602.9E-24105162IPR009057Homeodomain-like
PfamPF059202.0E-17118157IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MKITQQIPKS EIRNQDLCIR VSPGEGTGAT MSDDEDDNVD SDTDLYDGGL DGGQDTVGLG  60
PLIPTESERS LMERVRQELK VDLKQGYKAK IADVREEILR KRRAGKLPGD TTSRLKTWWQ  120
SHSKWPYPTE DEKARLVQET GLQLKQINNW FINQRKRNWH SNPSSSTTLK SKRKRAFFKL  180
GEKLIKLARE VEAWEVIVCR TVKIPMNFRA EEMS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A9e-14101165872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1154174RKRNWHSNPSSSTTLKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1229860.0BT122986.1 Picea sitchensis clone WS0464_E13 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013465816.14e-92class II knotted-like homeobox protein
SwissprotP480002e-89KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLD5A9W32e-98D5A9W3_PICSI; Putative uncharacterized protein
STRINGGSMUA_Achr7P05170_0013e-91(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11060.12e-71KNOTTED1-like homeobox gene 4