PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf13415g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family NF-YA
Protein Properties Length: 312aa    MW: 34160.5 Da    PI: 7.4718
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf13415g00005.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.81.3e-31168224158
                 CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                               +ep+YVNaKQy++Il+RR++Rak+e ekkl +k rkpylheSRh+hAl+R+R+sgGrF
  Peinf101Scf13415g00005.1 168 QEPVYVNAKQYHGILRRRESRAKAELEKKL-IKVRKPYLHESRHQHALKRARASGGRF 224
                               69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.7E-34166227IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.073167227IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.8E-27169224IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.9E-23170192IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860172192IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.9E-23201224IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MQSKSENANC GEARTYNVPN SFVNSEPWWN TAGYNPVSLG LMRGSASDSS SREHSVDGQT  60
QSDGGVNDED DDAPEKSQST VPIHPDGSYA QVDQSLQQIA SIIPPRVDGS LTQPPQLELV  120
GHTIGCAPNL YADPYYGGMM TPFGQPMVPP NVLDMHHARM PLPHEMAQEP VYVNAKQYHG  180
ILRRRESRAK AELEKKLIKV RKPYLHESRH QHALKRARAS GGRFARKSDA DTSKGTSSGS  240
AVSSQSRCTS GSEPLPSSTA DVREKHNDGS LTERQHSYSN GNGYGKQNSF HESKYQPQST  300
HFGEGGSAIK QW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-19168242276NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006366543.11e-178PREDICTED: nuclear transcription factor Y subunit A-1-like
TrEMBLM1AQ621e-178M1AQ62_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000277851e-177(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31112248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.45e-55nuclear factor Y, subunit A1