PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf12610g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family CO-like
Protein Properties Length: 304aa    MW: 34395.7 Da    PI: 6.5007
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf12610g00001.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.93.7e-07335436
                  zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                              r+C+ ++   ++ fC+ +  +lC  C +++H  
  Peinf101Scf12610g00001.1  3 RRCDSCKTTSATVFCKADMAFLCLGCDSKIHAA 35
                              79******99*********************54 PP

2zf-B_box24.65.4e-084590342
                  zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                               ++C+ +e+ +++  C+ +   lC +C   +H+       H++ p+
  Peinf101Scf12610g00001.1 45 VWVCEVCEHAPASVTCKADAAALCVTCDHDIHSAnplarrHERLPI 90
                              689*****************************66888888998876 PP

3CCT705.8e-24241285145
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                               Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++e
  Peinf101Scf12610g00001.1 241 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRNE 285
                               9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.1E-9147IPR000315B-box-type zinc finger
PROSITE profilePS501199.84147IPR000315B-box-type zinc finger
PfamPF006433.4E-5342IPR000315B-box-type zinc finger
CDDcd000214.01E-6347No hitNo description
PROSITE profilePS5011910.7514390IPR000315B-box-type zinc finger
PfamPF006432.6E-64590IPR000315B-box-type zinc finger
CDDcd000212.73E-74690No hitNo description
SMARTSM003362.2E-94890IPR000315B-box-type zinc finger
PfamPF062034.1E-18241283IPR010402CCT domain
PROSITE profilePS5101716.787241283IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MARRCDSCKT TSATVFCKAD MAFLCLGCDS KIHAANKLAS RHARVWVCEV CEHAPASVTC  60
KADAAALCVT CDHDIHSANP LARRHERLPI VPFYDSASAK SRAADETQQP ETEEEAEAES  120
WLLQAPNTNN NIGFEGNEYN KSAEYLFSDV DPYVDMEMIT DQKPCTDIQL HQEYKEADCV  180
VPHVQNKNNN EMIHLQGPVV DGYPTYHEMD FTGSKPFMYN FSTQSISQSV CTLIPLSSLD  240
REARVLRYRE KRKNRKFEKT IRYASRKAYA ETRPRIKGRF AKRNEIEIDS LIASEASYGV  300
VPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009604722.11e-163PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
RefseqXP_016495106.11e-163PREDICTED: zinc finger protein CONSTANS-LIKE 4-like isoform X2
SwissprotQ940T92e-88COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A1S4C1S71e-161A0A1S4C1S7_TOBAC; zinc finger protein CONSTANS-LIKE 4-like isoform X2
STRINGXP_009604722.11e-162(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.13e-88CONSTANS-like 4