PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf07353g00026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family HD-ZIP
Protein Properties Length: 285aa    MW: 32070.2 Da    PI: 4.6575
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf07353g00026.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.19.7e-2164117356
                               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               k++++t+eq++ Le+ Fe ++++  +++ +LA+klgL+ rqV vWFqNrRa++k
  Peinf101Scf07353g00026.1  64 KKRRLTPEQVHLLEKSFETENKLEPDRKSQLAQKLGLQPRQVAVWFQNRRARWK 117
                               5678*************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.22E-2049121IPR009057Homeodomain-like
PROSITE profilePS5007118.25359119IPR001356Homeobox domain
SMARTSM003892.0E-2062123IPR001356Homeobox domain
PfamPF000467.3E-1864117IPR001356Homeobox domain
CDDcd000862.17E-2064120No hitNo description
Gene3DG3DSA:1.10.10.601.8E-2265126IPR009057Homeodomain-like
PRINTSPR000313.1E-69099IPR000047Helix-turn-helix motif
PROSITE patternPS00027094117IPR017970Homeobox, conserved site
PRINTSPR000313.1E-699115IPR000047Helix-turn-helix motif
PfamPF021832.7E-17119161IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MESGRIFFDP SCNGNMLFLG HGDSIFRGAR SMMKMEDSSK RRPFFTSPED LYDEEYYDEQ  60
SPEKKRRLTP EQVHLLEKSF ETENKLEPDR KSQLAQKLGL QPRQVAVWFQ NRRARWKTKQ  120
LERDYDHLKS SYDSLLSDFD SITKDNDKLK AEVASLLEKL QGKVVGSGAV TSEKSEGLEV  180
DAAMTLQVKV KAEDRLSSGS GGSAVVDEHS PQLVDSGDSY VHTGHEEYAG VGGYNIPPPV  240
DGLNSEEDDG SDDGSCHGYF SNVFVAAEEH HHHEEEGEPL GWFWS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111119RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006338548.11e-170PREDICTED: homeobox-leucine zipper protein HAT5
SwissprotQ022838e-97HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLM0ZIA11e-170M0ZIA1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000013221e-170(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA78912330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-79homeobox 1