PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf06431g00032.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family HD-ZIP
Protein Properties Length: 355aa    MW: 40323.9 Da    PI: 6.373
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf06431g00032.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.11.2e-17134187356
                               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Peinf101Scf06431g00032.1 134 KKRRLNLEQVKALERSFEVANKLEPERKMQLARALGLKPRQIAIWFQNRRARWK 187
                               4557899**********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.03E-18129191IPR009057Homeodomain-like
SMARTSM003891.2E-16132193IPR001356Homeobox domain
PROSITE profilePS5007116.487133189IPR001356Homeobox domain
CDDcd000866.09E-16134190No hitNo description
PfamPF000466.4E-15134187IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.8E-19136196IPR009057Homeodomain-like
PRINTSPR000311.8E-5160169IPR000047Helix-turn-helix motif
PROSITE patternPS000270164187IPR017970Homeobox, conserved site
PRINTSPR000311.8E-5169185IPR000047Helix-turn-helix motif
CDDcd146860.00195180224No hitNo description
PfamPF021837.6E-16189228IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MFSGTTGIMA FVPTTPEISI NFQTHEDNHH LPSTSTKVFP SSCIPHQDFN ANNNMFSGTT  60
GIMAFVPTTP EISINFQTHE DNHHLPSTST KVFPSSCVSS MLMRRSMCDN HQDLRVDHDE  120
MSDDDGSSHL LGEKKRRLNL EQVKALERSF EVANKLEPER KMQLARALGL KPRQIAIWFQ  180
NRRARWKTKQ LEKDYEILKR QYDALKADND SLKTQNKKLH SELQLLTLKN RESVGGTAPM  240
INLNKENDQG SWSNGSDDNN SIDVNLGTTT TTRTSSCDSP FYSNTQTNNK NVMFPVSSPM  300
PTASLAQFLQ SSSRQDDLQC HKIDPTVPDE GFCNMFTPVD DQTNYWPWPE QQQFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1181189RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009624441.11e-166PREDICTED: homeobox-leucine zipper protein ATHB-13-like isoform X1
RefseqXP_016465587.11e-166PREDICTED: homeobox-leucine zipper protein ATHB-13-like
RefseqXP_016464196.11e-166PREDICTED: homeobox-leucine zipper protein ATHB-13-like isoform X1
TrEMBLK4BBU01e-136K4BBU0_SOLLC; Uncharacterized protein
STRINGSolyc02g087840.2.11e-136(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8482498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.13e-62HD-ZIP family protein