PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf05738g00029.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family NAC
Protein Properties Length: 244aa    MW: 28362.7 Da    PI: 4.966
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf05738g00029.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.63.4e-5591361128
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyW 83 
                               lppGfrFhPtdeelv++yLk+k++g+++el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyW
  Peinf101Scf05738g00029.1   9 LPPGFRFHPTDEELVNYYLKRKIHGQEIEL-DIIPEVDLYKCEPWELAeKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYW 92 
                               79****************************.99**************84335556888*************************** PP

                       NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               k+tgkd++v+s +++++g+kktLv+y+grap+g +tdWvmheyrl
  Peinf101Scf05738g00029.1  93 KSTGKDRRVTS-QNRAIGMKKTLVYYRGRAPQGIRTDWVMHEYRL 136
                               ***********.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-634161IPR003441NAC domain
PROSITE profilePS5100560.1079161IPR003441NAC domain
PfamPF023652.1E-3010136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
RSIMAPVGLP PGFRFHPTDE ELVNYYLKRK IHGQEIELDI IPEVDLYKCE PWELAEKSFL  60
PSRDPEWYFF GPRDRKYPNG FRTNRATRAG YWKSTGKDRR VTSQNRAIGM KKTLVYYRGR  120
APQGIRTDWV MHEYRLDDKE CEQETSGIQV DSYALCRVFK KNGVCSEIEE LGQPSSVPSF  180
EYPTQGINVH EYQTPSPDVQ LASSSYMEEE EKDDSWMQFI TEDAWCSSTS PFHGEEISPL  240
AFTN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-5711617168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019225972.11e-170PREDICTED: NAC domain-containing protein 86 isoform X1
SwissprotQ9FFI51e-88NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A314KSR41e-168A0A314KSR4_NICAT; Nac domain-containing protein 86
STRINGXP_009621551.11e-163(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46212442
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-125NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]