PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf04293g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family HD-ZIP
Protein Properties Length: 384aa    MW: 44154.2 Da    PI: 4.7017
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf04293g00005.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.64.5e-18118171356
                               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               k++++  +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Peinf101Scf04293g00005.1 118 KKRRLRVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 171
                               45578899*********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.27E-18102173IPR009057Homeodomain-like
PROSITE profilePS5007117.135113173IPR001356Homeobox domain
SMARTSM003893.6E-16116177IPR001356Homeobox domain
CDDcd000861.11E-14118173No hitNo description
PfamPF000462.5E-15118171IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.7E-19125172IPR009057Homeodomain-like
PRINTSPR000311.2E-5144153IPR000047Helix-turn-helix motif
PROSITE patternPS000270148171IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5153169IPR000047Helix-turn-helix motif
PfamPF021832.4E-14173214IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MFIFSCLLIS ETNISDRKKN KKSLLLTLLF PFQLFSPSLP VQNFLTETKN YCTFKKLKTM  60
KRVRSTDSLG APMMSMCQNT TDDNHQWNSQ VYSRDYQSML EGLDDEACME ESGNVSEKKR  120
RLRVDQVKAL EKNFEVENKL EPERKVKLAQ ELGLQPRQVA VWFQNRRARW KTKTLERDYN  180
VLKANFDSLK QNYESLQHDN EALLKELCEL KSKLHGENIE SKVSVKEEAI ESESHDDKDV  240
DQSKPNNSTC LGKCEDDDNA ELNFVESFKG ETCIMNDTIF ADFKDGSSDS DSSAILNEDN  300
GAFLISNSSS SANSSLNCFQ FLDSNAKSIF GDAHKVNYQP QFVKMEEHNF FSGEESCSTL  360
FSDEQAPSLQ WYCPEEWNWK DTPN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754448e-75HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009588928.11e-170PREDICTED: homeobox-leucine zipper protein ATHB-6-like
RefseqXP_016500042.11e-170PREDICTED: homeobox-leucine zipper protein ATHB-6-like
TrEMBLM1BEC01e-138M1BEC0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000432511e-138(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27182453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.11e-59homeobox protein 16