PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf04166g00018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family GRAS
Protein Properties Length: 989aa    MW: 111675 Da    PI: 5.5193
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf04166g00018.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS264.53.6e-81864544374
                      GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal..ppsetseknsseelaalkl... 83 
                               lLl  Ae+++ +++ +a++lL+   + + ++g+p+qR++ yf+eAL +r++r +++l +++  ++++ s+++++e+l+  ++   
  Peinf101Scf04166g00018.1  86 LLLVSAEMLAIQQFDRARKLLNVCINCSFSTGNPIQRAVYYFAEALIKRINR-GTGLPSTItaNVNAVSPDDMEEVLMDPRIdvi 169
                               788899**********************************************.55555555335666667778888888777878 PP

                      GRAS  84 .fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLa 166
                                  ++ P+ k++++t  qaIle++++ +r+H iD++i+ G QW  L+qaL s+ e p   l+iT+vg     s ++++e+g+rL+
  Peinf101Scf04166g00018.1 170 eTEQMLPFRKVTQFTGIQAILESIKSFRRIHLIDLGIKTGSQWTILMQALVSQGECPLeLLKITAVGT----SLTRIQEIGKRLS 250
                               899************************************************998555449********....9************ PP

                      GRAS 167 kfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse 251
                               +fAe+l++pf+f++ v+++l +++   +++k gE+la+    +  +l + + +l+s    +++++ksl P v+vv+e ea +n++
  Peinf101Scf04166g00018.1 251 SFAETLNIPFSFRT-VVSDLRNIKKAFFELKAGEVLAIYADSRFWTLIAWPNDLKS----LIQVIKSLDPCVMVVTEIEAYTNAP 330
                               **************.7999*****************************88888888....************************* PP

                      GRAS 252 sFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakq 336
                                F +rf eal yysa+fd+le+ ++ ++++r++   ++lg+ i+nv++ eg+e ++rh +l  Wr  +e++G+++ +ls++   q
  Peinf101Scf04166g00018.1 331 IFIDRFNEALFYYSAIFDCLETCIGWNHQQRAVAQGVYLGKIIENVITSEGEEMVHRHVKLDCWRTLFEKSGLEETELSHSSLYQ 415
                               ************************************************************************************* PP

                      GRAS 337 aklllrkvksdgy.rveeesgslvlgWkdrpLvsvSaWr 374
                               akll ++   +g+ ++e + +sl++ Wk+ p+ s+S+W+
  Peinf101Scf04166g00018.1 416 AKLLAERSTCHGFcSLEMDGKSLIIKWKGTPIKSLSVWK 454
                               *********999637889999999**************8 PP

2GRAS246.41.1e-756229854374
                      GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl..fse 86 
                               +L + Ae+  +++  +a++ L+     as +g+p+qR++ yf+eAL+ ++ +  +++  a  ++  +  +++++l+      f++
  Peinf101Scf04166g00018.1 622 QLHASAEFYVQKQYGKARKWLSLCYPSASVTGNPVQRVVYYFAEALRDKIDK-ETGTTPAEGSKMLKGVDVEDALMLIPSarFQQ 705
                               678889999999999************************************9.33333333333444444666665555478*** PP

                      GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAe 170
                               + P+ k++++   qa+l+ v +++r+H iD++i+ Gl +p +++aLa+R+e p   l+iT+vg     s++++eetg+ L++fAe
  Peinf101Scf04166g00018.1 706 AVPFSKIAQFPGMQAVLDNVMSAKRIHLIDLGIQSGLPFPIIMNALANRNECPVeLLKITAVGT----SRQRIEETGKMLSSFAE 786
                               **************************************************7665499*******....9**************** PP

                      GRAS 171 elgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFle 255
                               ++++pf f++ v+ +l+dl+ e++++++gE++aV + ++l ++l+ + +le+    +++++ksl+P v+vv+e ea++n++sF++
  Peinf101Scf04166g00018.1 787 QMNIPFLFSM-VVLELKDLRKENIELEEGEVVAVYSEFRLWTMLAWPNHLED----LVRVIKSLKPSVMVVSEVEASTNTPSFMN 866
                               **********.7999*****************************77777777....***************************** PP

                      GRAS 256 rflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakll 340
                               rf   ++y+sa fd+l + + +++++r+  E  +l++ i++v+  eg++r+ +h + + Wre + ++G  + ++s +   qa+ll
  Peinf101Scf04166g00018.1 867 RFDALVSYCSATFDCLGTCMKPDDKHRAIAEGIFLREMIQSVIIVEGEDRI-QHARISFWREFFARFGIVETEFSASSLYQADLL 950
                               *************************************************66.5778***************************** PP

                      GRAS 341 lrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               ++ ++ ++  ++e + ++l+  Wk+ p+ s+SaW+
  Peinf101Scf04166g00018.1 951 IQSTEcWKSCSWEFDGKCLITKWKGTPVNSLSAWK 985
                               *****9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.82257433IPR005202Transcription factor GRAS
PfamPF035141.3E-7886454IPR005202Transcription factor GRAS
PROSITE profilePS5098535.294593964IPR005202Transcription factor GRAS
PfamPF035144.0E-73622985IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 989 aa     Download sequence    Send to blast
MDSHQPKNSY FHEGKKGKVN EMNLDMPSDV SGSPVLSTTT IMNIARDQLF HYTSQNYDAY  60
SIIFSPLISD LGLSPQVTEE VELALLLLVS AEMLAIQQFD RARKLLNVCI NCSFSTGNPI  120
QRAVYYFAEA LIKRINRGTG LPSTITANVN AVSPDDMEEV LMDPRIDVIE TEQMLPFRKV  180
TQFTGIQAIL ESIKSFRRIH LIDLGIKTGS QWTILMQALV SQGECPLELL KITAVGTSLT  240
RIQEIGKRLS SFAETLNIPF SFRTVVSDLR NIKKAFFELK AGEVLAIYAD SRFWTLIAWP  300
NDLKSLIQVI KSLDPCVMVV TEIEAYTNAP IFIDRFNEAL FYYSAIFDCL ETCIGWNHQQ  360
RAVAQGVYLG KIIENVITSE GEEMVHRHVK LDCWRTLFEK SGLEETELSH SSLYQAKLLA  420
ERSTCHGFCS LEMDGKSLII KWKGTPIKSL SVWKFHNIQI EIIVINTLNT KRYLVSHLFG  480
LELILERGES ERVILAIIPK SVKVDMDSFS EDQATKEVND QPLIPDVAEE KMENSCPLSA  540
PILTLLQKFD SHFRHLRAEK LNEKVSDTPC SSIELPSTDE IMKMARAKLV QHMSTNSSIY  600
SIYLIPSGLP PEIADDVELA LQLHASAEFY VQKQYGKARK WLSLCYPSAS VTGNPVQRVV  660
YYFAEALRDK IDKETGTTPA EGSKMLKGVD VEDALMLIPS ARFQQAVPFS KIAQFPGMQA  720
VLDNVMSAKR IHLIDLGIQS GLPFPIIMNA LANRNECPVE LLKITAVGTS RQRIEETGKM  780
LSSFAEQMNI PFLFSMVVLE LKDLRKENIE LEEGEVVAVY SEFRLWTMLA WPNHLEDLVR  840
VIKSLKPSVM VVSEVEASTN TPSFMNRFDA LVSYCSATFD CLGTCMKPDD KHRAIAEGIF  900
LREMIQSVII VEGEDRIQHA RISFWREFFA RFGIVETEFS ASSLYQADLL IQSTECWKSC  960
SWEFDGKCLI TKWKGTPVNS LSAWKFPHD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-3711698520375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006358212.10.0PREDICTED: DELLA protein RGL2-like
TrEMBLK4AWA30.0K4AWA3_SOLLC; Uncharacterized protein
STRINGSolyc01g059960.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85001728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-52RGA-like 2