PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf03573g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family Dof
Protein Properties Length: 246aa    MW: 27796 Da    PI: 6.8888
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf03573g00007.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof112.12.5e-35763359
                    zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                               + lkcprC+s+ntkfCyynny+ +qPr+fCk+C+r+Wt+GG lrnvPvGggr++++
  Peinf101Scf03573g00007.1  7 PEPLKCPRCESSNTKFCYYNNYNKTQPRHFCKGCKRHWTEGGILRNVPVGGGRKNKR 63
                              6789**********************************************9976554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.3E-30962IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-23963IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.0181064IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101248IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MGLSTKPEPL KCPRCESSNT KFCYYNNYNK TQPRHFCKGC KRHWTEGGIL RNVPVGGGRK  60
NKRFKSDTSS TSIPGDKSIS QIVVQSKQNL QNFDPLVRRT IDDKKTIVSD NIFYPEQNFL  120
SSSLPYDTIE NNNTNINTGH VPRDENMLVF SFSSSTIGSI EKTIPSFIPT STQSSNVYNY  180
MEESTVTTVT PMTCCSLVSQ PWQRPGTSNV MDNNLPNYWN WNDIDALVSA DPDILLDDDH  240
NAEFKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016507077.16e-67PREDICTED: dof zinc finger protein DOF2.5-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.17e-31Dof family protein