PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf03470g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family GRAS
Protein Properties Length: 960aa    MW: 108022 Da    PI: 6.0142
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf03470g00004.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS247.55.2e-761154514350
                      GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                               lL + Ae +s+++++ a+++L+  ++ as +g+p+qRl+ +f eAL++ + ++++++ + lp  +     + e +   +++  ++
  Peinf101Scf03470g00004.1 115 LLQASAERFSNQQFKHARKFLSLCNQSASATGTPVQRLVYCFGEALREIIDKETKSITS-LPLDRPG-GFELEPIDHEEVL--LC 195
                               677889**********************************************7777764.3333333.2355555555555..8* PP

                      GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfA.ee 171
                               P + +++++  qaIl+ v+ e+r+H iDf+i+ G +W+ L+qaLa+R   +   l+iT+vg     sk+++e +g+rL++fA ee
  Peinf101Scf03470g00004.1 196 PKPHVAQFAGIQAILDNVKLERRLHLIDFGIKSGSHWIILMQALANRGdCQLELLKITAVGT----SKQMIEDIGQRLSSFAaEE 276
                               ***********************************************9556779********....9**************7378 PP

                      GRAS 172 lgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFler 256
                               ++vpf+f++ v++++ +l+ + +++++ Ea+aV   ++l  +l+ + +le     vL+++ksl+P v+vv++ ea++n+++F+er
  Peinf101Scf03470g00004.1 277 MKVPFSFKA-VVSEMRNLSKDLFEIDSTEAVAVYTDYRLAGMLAWPDHLEA----VLRFIKSLNPCVMVVIDTEANTNAPTFMER 356
                               *********.7999****************************966666665....****************************** PP

                      GRAS 257 flealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklll 341
                               f eal  y+a+fdsl++ ++++++ r+ vE  +l++ i n++a eg+er+ r+ +le Wr+ ++++G k+ +lse+   qa+ll 
  Peinf101Scf03470g00004.1 357 FNEALFLYAAVFDSLQTCMGQNNQSRMAVEGLILRKIIHNMIASEGEERIFRNVRLEVWRALFDKFGIKETELSESSLYQAHLLA 441
                               ************************************************************************************* PP

                      GRAS 342 rkvk.sdgyr 350
                               ++ + + g++
  Peinf101Scf03470g00004.1 442 ERAApDCGMS 451
                               9998666665 PP

2GRAS31.91.7e-10516580142210
                      GRAS 142 lRiTgvgspesgskeeleetgerLakf.AeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlql 210
                               + iT+vg     sk+++ee+g+rL++f Ae+++vpf+f++ v++++++l+ + ++++ +E++aV + ++l
  Peinf101Scf03470g00004.1 516 FLITAVGT----SKQMVEEIGQRLSSFtAENMKVPFSFKA-VVSDMKNLNKDIFELDANEVVAVYSEYHL 580
                               569*****....9*************97899*********.7999*******************998877 PP

3GRAS253.48.5e-7861595631374
                      GRAS  31 aspdgdpmqRlaayfteALaarlarsvselykal..ppsetseknsseelaalkl....fsevsPilkfshltaNqaIleavege 109
                               +  d++p+qR++ yf+eAL +r++r +++l +++  ++++ s+++++e+l+  ++      ++ P+ k++++t  qaIle++++ 
  Peinf101Scf03470g00004.1 615 QQFDRNPIQRAVYYFAEALIKRINR-GTGLPSTItaNVNAVSPDDMEEVLMDPRIdvieTEQMLPFRKVTQFTGIQAILESIKSF 698
                               445679*******************.55555555335666667778888888777878899************************ PP

                      GRAS 110 ervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                               +r+H iD++i+ G QW  L+qaL s+ e p   l+iT+vg     s ++++e+g+rL++fAe+l++pf+f++ v+++l +++   
  Peinf101Scf03470g00004.1 699 RRIHLIDLGIKTGSQWTILMQALVSQGECPLeLLKITAVGT----SLTRIQEIGKRLSSFAETLNIPFSFRT-VVSDLRNIKKAF 778
                               ************************998555449********....9**************************.7999******** PP

                      GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                               +++k gE+la+    +  +l + + +l+s    +++++ksl P v+vv+e ea +n++ F +rf eal yysa+fd+le+ ++ +
  Peinf101Scf03470g00004.1 779 FELKAGEVLAIYADSRFWTLIAWPNDLKS----LIQVIKSLDPCVMVVTEIEAYTNAPIFIDRFNEALFYYSAIFDCLETCIGWN 859
                               *********************88888888....**************************************************** PP

                      GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgy.rveeesgslvlgW 362
                               +++r++   ++lg+ i+nv++ eg+e ++rh +l  Wr  +e++G+++ +ls++   qakll ++   +g+ ++e + +sl++ W
  Peinf101Scf03470g00004.1 860 HQQRAVAQGVYLGKIIENVITSEGEEMVHRHVKLDCWRTLFEKSGLEETELSHSSLYQAKLLAERSTCHGFcSLEMDGKSLIIKW 944
                               *******************************************************************999637889999999*** PP

                      GRAS 363 kdrpLvsvSaWr 374
                               k+ p+ s+S+W+
  Peinf101Scf03470g00004.1 945 KGTPIKSLSVWK 956
                               ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.7286454IPR005202Transcription factor GRAS
PfamPF035141.8E-73115451IPR005202Transcription factor GRAS
PfamPF035146.0E-8516580IPR005202Transcription factor GRAS
PROSITE profilePS5098538.486559935IPR005202Transcription factor GRAS
PfamPF035143.0E-75615956IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 960 aa     Download sequence    Send to blast
MDSSLGKTTN KGKDQIQTSH CTEARKESLC QPLESCKILQ KRCCRGNLKE RHYDIPCNNC  60
SGSHVPSTVS IIEMARAQLL HYTFKKPNCS IASNSLDADC GLSPEASKDL ELAFLLQASA  120
ERFSNQQFKH ARKFLSLCNQ SASATGTPVQ RLVYCFGEAL REIIDKETKS ITSLPLDRPG  180
GFELEPIDHE EVLLCPKPHV AQFAGIQAIL DNVKLERRLH LIDFGIKSGS HWIILMQALA  240
NRGDCQLELL KITAVGTSKQ MIEDIGQRLS SFAAEEMKVP FSFKAVVSEM RNLSKDLFEI  300
DSTEAVAVYT DYRLAGMLAW PDHLEAVLRF IKSLNPCVMV VIDTEANTNA PTFMERFNEA  360
LFLYAAVFDS LQTCMGQNNQ SRMAVEGLIL RKIIHNMIAS EGEERIFRNV RLEVWRALFD  420
KFGIKETELS ESSLYQAHLL AERAAPDCGM SPKASEDLEL ALLLQASSKM FYNRDYERDI  480
NQQAGFIWLI LESKVGRTGQ SSWKPLLIEL IVHLSFLITA VGTSKQMVEE IGQRLSSFTA  540
ENMKVPFSFK AVVSDMKNLN KDIFELDANE VVAVYSEYHL GGIPLISDLG LSPQVTEEVE  600
LALLLLVSAE MLAIQQFDRN PIQRAVYYFA EALIKRINRG TGLPSTITAN VNAVSPDDME  660
EVLMDPRIDV IETEQMLPFR KVTQFTGIQA ILESIKSFRR IHLIDLGIKT GSQWTILMQA  720
LVSQGECPLE LLKITAVGTS LTRIQEIGKR LSSFAETLNI PFSFRTVVSD LRNIKKAFFE  780
LKAGEVLAIY ADSRFWTLIA WPNDLKSLIQ VIKSLDPCVM VVTEIEAYTN APIFIDRFNE  840
ALFYYSAIFD CLETCIGWNH QQRAVAQGVY LGKIIENVIT SEGEEMVHRH VKLDCWRTLF  900
EKSGLEETEL SHSSLYQAKL LAERSTCHGF CSLEMDGKSL IIKWKGTPIK SLSVWKFHNV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3613595626375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006358212.10.0PREDICTED: DELLA protein RGL2-like
TrEMBLM1BZ600.0M1BZ60_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000562320.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85001728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.13e-52RGA-like 2