PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf02665g01028.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family SBP
Protein Properties Length: 1004aa    MW: 110882 Da    PI: 7.6128
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf02665g01028.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.51.2e-40152229178
                               --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                       SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                               +Cqve+C+adls+ak+yhrrhkvC+vhska ++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Peinf101Scf02665g01028.1 152 VCQVEDCQADLSNAKDYHRRHKVCDVHSKAVSALVGNVMQRFCQQCSRFHILQEFDEGKRSCRRRLAGHNKRRRKTHP 229
                               6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.8E-32146214IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.949150227IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-37151232IPR004333Transcription factor, SBP-box
PfamPF031105.3E-29153226IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.201.0E-6775895IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484035.12E-6775882IPR020683Ankyrin repeat-containing domain
CDDcd002042.14E-6776883No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1004 aa     Download sequence    Send to blast
METKIGGKIN QFYGPVVADL NLKAGGKKTM EWDLNDWNWD GDLFTAAPLN SVPSDCRSKQ  60
LFPIGSGVQE ITTGVSNSLS SGSDEMGLGI DKVRKELEKR RRAVVSEDDE LNDEAASLNL  120
KLGGQLYPIM ERGDGKSGKK SKVAGASSNR AVCQVEDCQA DLSNAKDYHR RHKVCDVHSK  180
AVSALVGNVM QRFCQQCSRF HILQEFDEGK RSCRRRLAGH NKRRRKTHPE NVANGASVND  240
ERGSNYLLIS LLRILANIHY QTKDQDLLSH LLRNLASLAS AANERNAAGL QSATPDLRNT  300
GTTSGEICLK DSPQPTGQCM SIPTPEVREK RMGMGGADCG IPQNRGASQP DSLYHRKESI  360
PANANVPATS LAGMKLSNID LNNSYDDSQD GIGKVHNPDA TMNLGNGSTG YPLWLCQEPH  420
KSSPTRISGN SGSTSTLSPS NSSGESRTDR IVFKLFGKDP SDFPTTLRKQ ILDWLAHSPT  480
DIESYIRPGC IILTIYLRMD KSIWEELYCD LSSSLTKLLN ASTDSFWRTG WVYARVQHRV  540
AFIFNGQVVL DTPLPVTSHR NCRISIIKPL AVSASEGVQF LVKGFNLSRP TTRLLCALEG  600
KYLVQGSCTD MMGGVDSYIE HDEPQSLGFP CIMPNITGRG FIEVEDHGLC SSFFPFIVAE  660
KDVCSEIRTL ENIIEVAETA DGSLGETEEL QARDQALDFI HEMGWLLHRS QLQLRLGSGS  720
NLNLFPFERF KWLIEFSVDH AWCAVVKNLL GIFFNGIVDV RQHSSLDIAL QEVGVLHRAV  780
RGNNRSVVEM LLRYSPSGVL DKSGVENQQG RGSYLFRPDT EGPGGLTPLH IVASLDGYDG  840
LLEALIDDPE QIGTEAWRSA RDSTGLTPND YASLRGHYSY IHIVQKKINQ KSSSGHVVVN  900
IPGTLLNSSF KQKLQDDHKS VKVGSLQMEK PLMKPIQRHC RQCERKFSYG NMGTTSVAIY  960
RPAMLSMVAI AAICVCVALL FKSSPEVLYV FKPFRWEQLK YGSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-31144226284squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1221227KRRRKTH
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754402e-56HG975440.1 Solanum pennellii chromosome ch01, complete genome.
GenBankHG9754412e-56HG975441.1 Solanum pennellii chromosome ch02, complete genome.
GenBankHG9754442e-56HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019253402.10.0PREDICTED: squamosa promoter-binding-like protein 1
TrEMBLA0A2K9ZXI90.0A0A2K9ZXI9_PETHY; Squamosa promoter binding-like protein 12d
STRINGSolyc05g053240.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1