PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf02395g01020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family HD-ZIP
Protein Properties Length: 265aa    MW: 30511 Da    PI: 7.0336
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf02395g01020.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.87.9e-184497356
                              --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                              k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Peinf101Scf02395g01020.1 44 KKRRLNLEQVKALERSFEVANKLEPERKMQLARALGLKPRQIAIWFQNRRARWK 97
                              4557899**********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.7E-1941101IPR009057Homeodomain-like
SMARTSM003891.2E-1642103IPR001356Homeobox domain
PROSITE profilePS5007116.4874399IPR001356Homeobox domain
PfamPF000464.1E-154497IPR001356Homeobox domain
CDDcd000864.38E-1544100No hitNo description
Gene3DG3DSA:1.10.10.608.1E-1946106IPR009057Homeodomain-like
PRINTSPR000311.1E-57079IPR000047Helix-turn-helix motif
PROSITE patternPS0002707497IPR017970Homeobox, conserved site
PRINTSPR000311.1E-57995IPR000047Helix-turn-helix motif
PfamPF021835.0E-1699138IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
VSSMLMRRSM SFSGVERCDN HQDLRVDHDE MSDDDGSSHL LGEKKRRLNL EQVKALERSF  60
EVANKLEPER KMQLARALGL KPRQIAIWFQ NRRARWKTKQ LEKDYEILKR QYDALKADND  120
SLKTQNKKLH SELQLLTLKN RESVGGTAQM INLNKENDQG SWSNGSDDNN SIDVNLGTTT  180
TTRTSSCDSP FYSNNTQSNN KNVMFPVSSP MPTTSLAQFL QSSSRQDLQC HKIDPTVPDE  240
GFCNMFTPVD DQTNYWPWPE QQQFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19199RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009624441.11e-154PREDICTED: homeobox-leucine zipper protein ATHB-13-like isoform X1
RefseqXP_016465587.11e-154PREDICTED: homeobox-leucine zipper protein ATHB-13-like
TrEMBLK4BBU01e-128K4BBU0_SOLLC; Uncharacterized protein
STRINGSolyc02g087840.2.11e-127(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8482498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.14e-59HD-ZIP family protein