PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf02318g03012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family BBR-BPC
Protein Properties Length: 301aa    MW: 33919.7 Da    PI: 9.8009
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf02318g03012.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind289.11.9e-881630127301
                 GAGA_bind  27 qlmssiaerdakirernlalsekkaavaerd...............maflqrdkalae....rnkalverdnkllalllvensla 92 
                               ++ ++ aerd++i+er+ a+ +    + erd                a+ +rd a+++    r+ al erdn+++al + e +++
  Peinf101Scf02318g03012.1  16 KIRTLSAERDTAIEERDRAVEA----LEERDlaiqraleerdlamqRALEERDLAIQQviseRDTALKERDNAIAALHFLESTMN 96 
                               4444455888888666664432....222222222223333377666677788776655555*****************999866 PP

                 GAGA_bind  93 salpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkk 177
                                +l  g+   +gtk  ++ ++ ++ + ++sa  +r+  +++a+pi+   ++a ++ ++k+++ +k   +k ak+++k ++k  ++
  Peinf101Scf02318g03012.1  97 GTL--GC-RTRGTKRPNQPKH-HRDNSTNSACIQRDVPITDAFPISAISSKAAKAVQVKRTKVNKGMPTKSAKSPRK-TKKVSED 176
                               554..33.4577777775555.44566666666799999******99999998888888666655555555555555.4444455 PP

                 GAGA_bind 178 vkkesaderskaekksidl.vlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmS 261
                                +++ + + skae++ +dl +ln +++Dest+P+PvC+CtG +rqCYkWG+GGWqS+CCtt +S yPLP+ +++r+aRi+grKmS
  Peinf101Scf02318g03012.1 177 LNRHLTTDGSKAEWDAQDLgSLNLINFDESTMPIPVCTCTGLPRQCYKWGSGGWQSSCCTTYLSEYPLPQLPNKRHARIGGRKMS 261
                               5666656789*********88**************************************************************** PP

                 GAGA_bind 262 qgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                               +++f++lL +La+ Gydls pvDLk++WAkHGtn+++ti+
  Peinf101Scf02318g03012.1 262 GSVFSRLLTRLASAGYDLSIPVDLKTYWAKHGTNRYITIK 301
                               ***************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012264.3E-997301IPR010409GAGA-binding transcriptional activator
PfamPF062173.1E-898301IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MLPHYQMDQE TFIMKKIRTL SAERDTAIEE RDRAVEALEE RDLAIQRALE ERDLAMQRAL  60
EERDLAIQQV ISERDTALKE RDNAIAALHF LESTMNGTLG CRTRGTKRPN QPKHHRDNST  120
NSACIQRDVP ITDAFPISAI SSKAAKAVQV KRTKVNKGMP TKSAKSPRKT KKVSEDLNRH  180
LTTDGSKAEW DAQDLGSLNL INFDESTMPI PVCTCTGLPR QCYKWGSGGW QSSCCTTYLS  240
EYPLPQLPNK RHARIGGRKM SGSVFSRLLT RLASAGYDLS IPVDLKTYWA KHGTNRYITI  300
K
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9823150.0FJ982315.1 Solanum tuberosum GAGA-binding transcriptional activator (BBR/BPC4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009804622.11e-173PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_009804621.11e-173PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_016442557.11e-173PREDICTED: protein BASIC PENTACYSTEINE4-like
TrEMBLK4B3R01e-166K4B3R0_SOLLC; Uncharacterized protein
STRINGSolyc01g110470.2.11e-166(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA92872128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.24e-90basic pentacysteine 4