PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf02263g03015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family CO-like
Protein Properties Length: 437aa    MW: 49356.3 Da    PI: 5.3095
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf02263g03015.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box29.61.4e-091659340
                  zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                              +r C+++ +k+++++C  ++ +lC++C ++ H+       H++v
  Peinf101Scf02263g03015.1 16 ARACDNCIRKRARWYCPADDAFLCQNCDSSVHSAnplarrHERV 59
                              578*****************************667888888876 PP

2CCT67.34.2e-23388430143
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                               Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+
  Peinf101Scf02263g03015.1 388 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR 430
                               9****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.2E-111461IPR000315B-box-type zinc finger
PROSITE profilePS5011910.951461IPR000315B-box-type zinc finger
PfamPF006437.3E-81659IPR000315B-box-type zinc finger
CDDcd000212.86E-101761No hitNo description
PROSITE profilePS5101716.083388430IPR010402CCT domain
PfamPF062037.8E-18388430IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0016020Cellular Componentmembrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MVSERKLASA MGAKTARACD NCIRKRARWY CPADDAFLCQ NCDSSVHSAN PLARRHERVR  60
LKTLSLKESS SNDSSLNLKR SVPSWHRGFT RKARTPRQGK KLNKSNDEDE VILKNPLHLV  120
PEILSDENSL DENEEQLLYR VPIFDPFVAE LCSSATNEAK TGNVTNAIGN EYKEMLQHDD  180
NCNVDLNRFH HGMLPSEMEL AEFAADVESL LGKGLDDESF DMEGLGLLGS CNKEENSIEC  240
SMVSEKVKVE DEGEVEVVMD MNISHDDHQL IDTHDIDIEG ETFEFKFDYD SPVNVTGESE  300
VGEVGMKNSE VGAVGDGNNK KKILLNLDYE GVLTAWADQR SPWTNGERPE LDSNDCWPDC  360
MGNCGTIHPY GDMGIMNGQH ATIVDRGREA RVSRYREKRR TRLFSKKIRY EVRKLNAEKR  420
PRMKGRFVKR VNFAAAS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1398414RRTRLFSKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754442e-69HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankHG9755172e-69HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016463604.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16-like
SwissprotQ8RWD01e-103COL16_ARATH; Zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A3Q9WL220.0A0A3Q9WL22_PETHY; Zinc finger protein CONSTANS-like 16
STRINGXP_009777706.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15392470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.11e-100B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]