PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf02138g03014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family HD-ZIP
Protein Properties Length: 183aa    MW: 21758.6 Da    PI: 10.0545
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf02138g03014.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.83.8e-182475657
                              S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                  Homeobox  6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                              ++++eq++ Le+ F +++++ +e++ +LA++lg++ rq+++W+qNrRa++k+
  Peinf101Scf02138g03014.1 24 RLNQEQVKLLEASFDSTKKLETERKLQLARELGVPPRQISIWYQNRRARWKN 75
                              589***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.5321676IPR001356Homeobox domain
SMARTSM003895.9E-141880IPR001356Homeobox domain
SuperFamilySSF466891.96E-172185IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-192383IPR009057Homeodomain-like
CDDcd000866.53E-122476No hitNo description
PfamPF000461.7E-152475IPR001356Homeobox domain
PRINTSPR000312.5E-54756IPR000047Helix-turn-helix motif
PROSITE patternPS0002705174IPR017970Homeobox, conserved site
PRINTSPR000312.5E-55672IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MTSFLNSQNS QKHHYIPKHH NNKRLNQEQV KLLEASFDST KKLETERKLQ LARELGVPPR  60
QISIWYQNRR ARWKNQTLEV DYNALQIQLE TALSEKRQLE KETERLREEL QKANEMLSAL  120
NEGQGQREII PLSDYSISSC CEERGNSSFQ EDVRFRRTVQ MSFNFGDMKM KRILIWVSSR  180
TKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009791458.12e-71PREDICTED: homeobox-leucine zipper protein ATHB-52-like
RefseqXP_016444534.12e-71PREDICTED: homeobox-leucine zipper protein ATHB-52-like
TrEMBLM1AXC87e-59M1AXC8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000323902e-58(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27152453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.13e-24HD-ZIP family protein