PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf02138g02031.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family SBP
Protein Properties Length: 185aa    MW: 20888.4 Da    PI: 9.1093
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf02138g02031.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP136.48.8e-4373150178
                               --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                       SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                               +Cqve+C +dls ak+yh+rhkvCevh+kap vlv+gl+qrfCqqCsrfhelsefD +krsCrrrLa+hnerrrk+++
  Peinf101Scf02138g02031.1  73 CCQVEKCGTDLSYAKTYHKRHKVCEVHAKAPIVLVAGLRQRFCQQCSRFHELSEFDGTKRSCRRRLAGHNERRRKTSQ 150
                               6**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.9E-3567135IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.24871148IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.89E-3972151IPR004333Transcription factor, SBP-box
PfamPF031101.1E-3374147IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MFNFKKSMAT YNHAATRDLA DEGEDTEVED EEDEGLELID DKSRLKRKKL NLAKGAVKEG  60
ANSYGGGGVA QPCCQVEKCG TDLSYAKTYH KRHKVCEVHA KAPIVLVAGL RQRFCQQCSR  120
FHELSEFDGT KRSCRRRLAG HNERRRKTSQ GTKLEDNQCR QINGEGTPKL TFSSSNTSLK  180
NYQIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-35741471184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT7179641e-122KT717964.1 Petunia x hybrida squamosa promoter-binding protein 2 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009788885.11e-66PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_016481940.11e-66PREDICTED: squamosa promoter-binding-like protein 3
SwissprotQ387403e-46SBP2_ANTMA; Squamosa promoter-binding protein 2
TrEMBLA0A2K9ZXH71e-106A0A2K9ZXH7_PETHY; Squamosa promoter binding-like protein 4c
STRINGXP_009788885.15e-66(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.21e-40squamosa promoter binding protein-like 4
Publications ? help Back to Top
  1. Klein J,Saedler H,Huijser P
    A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA.
    Mol. Gen. Genet., 1996. 250(1): p. 7-16
    [PMID:8569690]