PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01724g02036.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family GRAS
Protein Properties Length: 1073aa    MW: 121361 Da    PI: 6.3669
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01724g02036.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS295.31.6e-902135831374
                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl.. 83 
                               lv+lLl++Ae v ++++++ ++l+++   +as +g+p+qRl +yf++AL++r+ r + +  ++ + ++ +   +++ ++ +++  
  Peinf101Scf01724g02036.1 213 LVHLLLAAAEEVGKQQFHQGSKLISHCMWTASDSGNPVQRLSFYFAKALQERIDRATGRYTNTDEDRHLKY--VKTMASGTNTef 295
                               68*****************************************************3333333333333332..222222222254 PP

                      GRAS  84 ..fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerL 165
                                  +++ P+ ++ +++  q+I e v +++++H iD++i  G+QW  L+qaLa+R  ++   l+iT+vgs   ++ke+ e+tg+ L
  Peinf101Scf01724g02036.1 296 ftCHQLLPFSQVMQFAGVQTIIENVRSAKKIHLIDLNIRSGIQWTVLMQALAERGdSPIEVLKITAVGS---TEKEKFEATGNTL 377
                               446799************************************************9444559********...58*********** PP

                      GRAS 166 akfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhns 250
                               ++fA++lg+pf+f+++  ++++d++ e+ +vk +E++aV +   l ++ +++ +l++    ++++v+s+ P+vvvv e ea+hns
  Peinf101Scf01724g02036.1 378 HSFAKSLGLPFSFDIVFLSDMKDFKQESVKVKADETVAVYCNCVLRTMISKPECLDN----LMRVVRSIGPTVVVVGEVEANHNS 458
                               ************************************************988888877....************************ PP

                      GRAS 251 esFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaak 335
                               +sFl+rf+e+l +ysa+fd++e  +  +s  r+++E  ++g+ i+n+va+eg+er+ r  +le Wr+ + ++G+ + +lse+   
  Peinf101Scf01724g02036.1 459 PSFLNRFIETLFFYSAFFDCFEDCMDGDSPCRTTIEGLYFGEGIRNIVAAEGKERFTRSVKLEVWRAFFPRFGMVEEELSESSWY 543
                               ************************************************************************************* PP

                      GRAS 336 qaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               qa+l+l++++ +  y ++++++ l++gWk+ p  s+S W+
  Peinf101Scf01724g02036.1 544 QANLILKQFAqGSSYDLHKDRKGLIIGWKGTPTHSLSIWK 583
                               **********8888*************************8 PP

2GRAS302.21.3e-9270410711374
                      GRAS    1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaal 81  
                                lv+ Ll++Ae vs+++  +a++lL++ + las++g+p+qR+++yfteAL +r+ r   e+ + +p s +++     s+  aa+
  Peinf101Scf01724g02036.1  704 LVQILLAAAERVSDQQYDRARKLLSQCQALASNAGNPVQRAVFYFTEALGERIDR---ETGRLMPNSCSDKGIciASRFDAAF 783 
                                6899***************************************************...5555555554443335466666777 PP

                      GRAS   82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetge 163 
                                 ++++  P+ ++ h+t  qaIle+v+++ +vH iDf i  G+QW++L+qa a+R+ ++  +++iT+++s   ++ke++ etg+
  Peinf101Scf01724g02036.1  784 VAWHQEVPFTQVVHFTGIQAILESVATKPKVHLIDFLIRTGVQWASLIQAAAERKdNPIEHMKITVIES---VDKERVAETGK 863 
                                779999************************************************955566*********...79********* PP

                      GRAS  164 rLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqea 246 
                                 L++fA++l+ p++f++++  + ++l++++L++k++Ea++V+ ++ l  +  e+  le      +++vk+l+P ++vv+e ea
  Peinf101Scf01724g02036.1  864 SLTSFAKSLNFPLSFKIVYLPDRNQLTVNHLDIKQDEAVVVQAAFFLRAMICEPDVLET----AMRVVKRLQPSLMVVSEVEA 942 
                                *****************9999*****************************977777766....******************** PP

                      GRAS  247 dhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvpl 329 
                                ++ns+ F++rf++al yysa+fd+le  + r++++r+++E +  ++ i+n+v  eg+er+ r  +l  Wr+ + ++G+k+v+l
  Peinf101Scf01724g02036.1  943 NLNSPLFVNRFIDALFYYSAFFDCLEDVMKRDNQNRMTLESVPYKEGIRNIVGSEGKERVSRSVNLDVWRSFFARFGMKEVKL 1025
                                *********************************************************************************** PP

                      GRAS  330 sekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374 
                                se+   qa+l+++++  ++  + + + gsl   Wk+ p++svSaW+
  Peinf101Scf01724g02036.1 1026 SETCLYQANLIIQQFTcKNSCSADVNGGSLAVSWKNTPIYSVSAWK 1071
                                ****************999999999********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.102187562IPR005202Transcription factor GRAS
PfamPF035145.4E-88213583IPR005202Transcription factor GRAS
PROSITE profilePS5098545.6376781050IPR005202Transcription factor GRAS
PfamPF035144.4E-907041071IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 1073 aa     Download sequence    Send to blast
MDNVSISNDN LTDFQGVHFH PEGDERSELV FSGVEDPWLE LEDCEDIDSL YSMCDLSNQE  60
NTSNKQVRTN LLERLQQSIS DRPHSHFPTN TVMPLQPVQI QSTVEAPKHD EVPETGNSSS  120
EKTNPFSSAS LDLLNNYGRL IKKSSVENLS NALSYKTCVG KSHKLSMEEI LMAAGERYIQ  180
YSTQRLDGLS MFIHPYGSAL SGLSMEETRD MELVHLLLAA AEEVGKQQFH QGSKLISHCM  240
WTASDSGNPV QRLSFYFAKA LQERIDRATG RYTNTDEDRH LKYVKTMASG TNTEFFTCHQ  300
LLPFSQVMQF AGVQTIIENV RSAKKIHLID LNIRSGIQWT VLMQALAERG DSPIEVLKIT  360
AVGSTEKEKF EATGNTLHSF AKSLGLPFSF DIVFLSDMKD FKQESVKVKA DETVAVYCNC  420
VLRTMISKPE CLDNLMRVVR SIGPTVVVVG EVEANHNSPS FLNRFIETLF FYSAFFDCFE  480
DCMDGDSPCR TTIEGLYFGE GIRNIVAAEG KERFTRSVKL EVWRAFFPRF GMVEEELSES  540
SWYQANLILK QFAQGSSYDL HKDRKGLIIG WKGTPTHSLS IWKIPRIFRT FVPTMGQLTQ  600
EKMKLHGLET GKDMEKAPFL SLAPFELLRN HPSRCKNIEG DKIRNMKDGT NVYQKLSAMQ  660
IMRLAGERFI QFSSHKFINI NNLLHPYGSA LSDLSPEDNQ DVELVQILLA AAERVSDQQY  720
DRARKLLSQC QALASNAGNP VQRAVFYFTE ALGERIDRET GRLMPNSCSD KGICIASRFD  780
AAFVAWHQEV PFTQVVHFTG IQAILESVAT KPKVHLIDFL IRTGVQWASL IQAAAERKDN  840
PIEHMKITVI ESVDKERVAE TGKSLTSFAK SLNFPLSFKI VYLPDRNQLT VNHLDIKQDE  900
AVVVQAAFFL RAMICEPDVL ETAMRVVKRL QPSLMVVSEV EANLNSPLFV NRFIDALFYY  960
SAFFDCLEDV MKRDNQNRMT LESVPYKEGI RNIVGSEGKE RVSRSVNLDV WRSFFARFGM  1020
KEVKLSETCL YQANLIIQQF TCKNSCSADV NGGSLAVSWK NTPIYSVSAW KFH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-45242107126375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006349181.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM1AI730.0M1AI73_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000233450.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.15e-52RGA-like 1