PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01648g01013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family NF-YA
Protein Properties Length: 364aa    MW: 40597.5 Da    PI: 8.7793
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01648g01013.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.91.2e-31212268158
                 CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                               +ep+YVNaKQy++Il+RRq Rak+e ekk  +k+rkpylheSRh+hA+rR+Rg+gGrF
  Peinf101Scf01648g01013.1 212 EEPVYVNAKQYHGILRRRQIRAKAELEKKA-IKARKPYLHESRHQHAMRRARGTGGRF 268
                               69***************************9.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.0E-36210271IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.039211271IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.9E-27213268IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.3E-24214236IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860216236IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.3E-24245268IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MPTIAKHDGR QLETGLRITS QSTTQMQPWW QGYGENTMPL ASESTIAQGN PDGGNQEKET  60
KALAIESGIF HITYYTVNIS SLYLSFESTI RLTSDDNSCE KKVTMLIMTK LSCSYLFRTM  120
ICMWLFISDE IIFSGSNGNN VPYQQNLKHI ASTAATVMGE QQKEHAGHST MLASYPYPDL  180
QYGAMMTYGA PVHPHLFEIH HGRMPLPLDM EEEPVYVNAK QYHGILRRRQ IRAKAELEKK  240
AIKARKPYLH ESRHQHAMRR ARGTGGRFLN TKKLNDMDCT SEDPKKSGAT IPTHSGNSSG  300
SGSSDQQEKD MHKGHSHSFL TGNNHGSSVY LSQNTGNEQG NGHYGRVSWS LLVNQASRGA  360
VSNN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A7e-20212273263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4897630.0AM489763.1 Petunia x hybrida partial mRNA for YA3 (nf-YA gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016443427.11e-143PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X1
TrEMBLM1A9B51e-130M1A9B5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000176981e-129(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA112322025
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.13e-28nuclear factor Y, subunit A7